Brand: ProteoGenix

Anti-Human CD63/LAMP3 Antibody (SAA1394), APC

ARO-A10253-50
Validated FC

Clonality:: Monoclonal Antibody
Host species:: Mouse
Isotype:: IgG1, kappa
Target species:: Human
Clone Name:: SAA1394

Original price was: €457.00.Current price is: €354.00.

50ug 23% OFF + 354 loyalty points

Size Size

50ug Original price was: €457.00.Current price is: €354.00.
100ug Original price was: €662.00.Current price is: €505.00.
1MG Original price was: €1,817.00.Current price is: €1,465.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CD63/LAMP3 Antibody (SAA1394), APC

Product name	ARO-A10253-100
Uniprot ID	P08962
Raw Antigen Sequence	MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-Ocular melanoma-associated antigen, TSPAN30, CD63 antigen, LAMP-3, Tetraspanin-30, OMA81H, Lysosomal-associated membrane protein 3, Tspan-30, Granulophysin, MLA1, Melanoma-associated antigen ME491, CD63
Reference	ARO-A10253
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	Ocular melanoma-associated antigen, TSPAN30, CD63 antigen, LAMP-3, Tetraspanin-30, OMA81H, Lysosomal-associated membrane protein 3, Tspan-30, Granulophysin, MLA1, Melanoma-associated antigen ME491, CD63
Clone Name	SAA1394
Target species	Human

Product name	ARO-A10253-1MG
Uniprot ID	P08962
Raw Antigen Sequence	MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-Ocular melanoma-associated antigen, TSPAN30, CD63 antigen, LAMP-3, Tetraspanin-30, OMA81H, Lysosomal-associated membrane protein 3, Tspan-30, Granulophysin, MLA1, Melanoma-associated antigen ME491, CD63
Reference	ARO-A10253
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	Ocular melanoma-associated antigen, TSPAN30, CD63 antigen, LAMP-3, Tetraspanin-30, OMA81H, Lysosomal-associated membrane protein 3, Tspan-30, Granulophysin, MLA1, Melanoma-associated antigen ME491, CD63
Clone Name	SAA1394
Target species	Human

Product name	ARO-A10253-50
Uniprot ID	P08962
Raw Antigen Sequence	MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-Ocular melanoma-associated antigen, TSPAN30, CD63 antigen, LAMP-3, Tetraspanin-30, OMA81H, Lysosomal-associated membrane protein 3, Tspan-30, Granulophysin, MLA1, Melanoma-associated antigen ME491, CD63
Reference	ARO-A10253
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	Ocular melanoma-associated antigen, TSPAN30, CD63 antigen, LAMP-3, Tetraspanin-30, OMA81H, Lysosomal-associated membrane protein 3, Tspan-30, Granulophysin, MLA1, Melanoma-associated antigen ME491, CD63
Clone Name	SAA1394
Target species	Human

Datasheet

Flow Cytometry results for Anti-Human CD63/LAMP3 Antibody (SAA1394), APC

Target Cells were stained with an irrelevant antibody or Anti-Human CD63/LAMP3 Antibody (SAA1394), APC at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD63/LAMP3 Antibody (SAA1394), APC”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *