Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

  • ARO-A10727-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Target species:
Human
Clone Name:
B88-9

Original price was: €443.00.Current price is: €354.00.

50ug 20% OFF + 354 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Product name ARO-A10727-100
Uniprot ID O75015
Raw Antigen Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Reference ARO-A10727
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Clone Name B88-9
Target species Human
Product name ARO-A10727-1MG
Uniprot ID O75015
Raw Antigen Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Reference ARO-A10727
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Clone Name B88-9
Target species Human
Product name ARO-A10727-50
Uniprot ID O75015
Raw Antigen Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Reference ARO-A10727
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target IGFR3, FCGR3B, CD16b, Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII, IgG Fc receptor III-1, FCGR3, CD16B, Fc-gamma RIII-beta, Fc-gamma RIIIb, FCG3, FcRIII, FcR-10, FcRIIIb
Clone Name B88-9
Target species Human

Flow Cytometry results for Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Flow Cytometry results for Anti-Human CD16b/FCGR3B Antibody (B88-9), PE

Flow-cytometry PE using anti-human CD16A antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an PE anti-human CD16A monoclonal antibody (Catalog ARO-A10727) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD16b/FCGR3B Antibody (B88-9), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products