“Recombinant Influenza A virus NP/Nucleoprotein Protein, N-GST & C-His” has been added to your cart. View cart

Brand: ProteoGenix

Anti-Human CCL24/Eotaxin-2/MPIF-2 Antibody (SAA0461), APC

ARO-A10499-50
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Mouse
Isotype:: IgG2a, kappa
Target species:: Human
Clone Name:: SAA0461

Original price was: €401.00.Current price is: €311.00.

50ug 22% OFF + 311 loyalty points

Size Size

50ug Original price was: €401.00.Current price is: €311.00.
100ug Original price was: €551.00.Current price is: €444.00.
1MG Original price was: €1,584.00.Current price is: €1,288.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CCL24/Eotaxin-2/MPIF-2 Antibody (SAA0461), APC

Product name	ARO-A10499-100
Uniprot ID	O00175
Raw Antigen Sequence	MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-MPIF2, Eosinophil chemotactic protein 2, Small-inducible cytokine A24, CCL24, Eotaxin-2, SCYA24, MPIF-2, Myeloid progenitor inhibitory factor 2, CK-beta-6, C-C motif chemokine 24
Reference	ARO-A10499
Note	For research use only.
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Target	MPIF2, Eosinophil chemotactic protein 2, Small-inducible cytokine A24, CCL24, Eotaxin-2, SCYA24, MPIF-2, Myeloid progenitor inhibitory factor 2, CK-beta-6, C-C motif chemokine 24
Clone Name	SAA0461
Target species	Human

Product name	ARO-A10499-1MG
Uniprot ID	O00175
Raw Antigen Sequence	MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-MPIF2, Eosinophil chemotactic protein 2, Small-inducible cytokine A24, CCL24, Eotaxin-2, SCYA24, MPIF-2, Myeloid progenitor inhibitory factor 2, CK-beta-6, C-C motif chemokine 24
Reference	ARO-A10499
Note	For research use only.
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Target	MPIF2, Eosinophil chemotactic protein 2, Small-inducible cytokine A24, CCL24, Eotaxin-2, SCYA24, MPIF-2, Myeloid progenitor inhibitory factor 2, CK-beta-6, C-C motif chemokine 24
Clone Name	SAA0461
Target species	Human

Product name	ARO-A10499-50
Uniprot ID	O00175
Raw Antigen Sequence	MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-MPIF2, Eosinophil chemotactic protein 2, Small-inducible cytokine A24, CCL24, Eotaxin-2, SCYA24, MPIF-2, Myeloid progenitor inhibitory factor 2, CK-beta-6, C-C motif chemokine 24
Reference	ARO-A10499
Note	For research use only.
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Target	MPIF2, Eosinophil chemotactic protein 2, Small-inducible cytokine A24, CCL24, Eotaxin-2, SCYA24, MPIF-2, Myeloid progenitor inhibitory factor 2, CK-beta-6, C-C motif chemokine 24
Clone Name	SAA0461
Target species	Human