Brand: ProteoGenix

Anti-Human CAV1/Caveolin-1 Antibody (ABS1042)

ARO-A17622-50
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: IgG2a, kappa

Original price was: €371.00.Current price is: €265.00.

50ug 29% OFF + 265 loyalty points

Size Size

50ug Original price was: €371.00.Current price is: €265.00.
100ug Original price was: €496.00.Current price is: €379.00.
1MG Original price was: €1,396.00.Current price is: €1,099.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human CAV1/Caveolin-1 Antibody (ABS1042)

Product name	ARO-A17622-100
Uniprot ID	Q03135
Raw Antigen Sequence	MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CAV1, Anti-Caveolin-1
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Protein Name	CAV1

Product name	ARO-A17622-1MG
Uniprot ID	Q03135
Raw Antigen Sequence	MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CAV1, Anti-Caveolin-1
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Protein Name	CAV1

Product name	ARO-A17622-50
Uniprot ID	Q03135
Raw Antigen Sequence	MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-CAV1, Anti-Caveolin-1
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Protein Name	CAV1