Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

  • ARO-A14929-50
  • Validated ELISA

Original price was: €378.00.Current price is: €272.00.

50ug 28% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

Product name ARO-A14929-100
Uniprot ID P03172
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Reference ARO-A14929
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Envelope glycoprotein D, gD, gD, US6, Human herpes simplex virus 2 (HSV-2), Human herpesvirus 2 (strain 333), Human herpes simplex virus 2, HHV-2
Target species Anti-Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2) Monoclonal Antibody
Product name ARO-A14929-1MG
Uniprot ID P03172
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Reference ARO-A14929
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Envelope glycoprotein D, gD, gD, US6, Human herpes simplex virus 2 (HSV-2), Human herpesvirus 2 (strain 333), Human herpes simplex virus 2, HHV-2
Target species Anti-Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2) Monoclonal Antibody
Product name ARO-A14929-50
Uniprot ID P03172
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Reference ARO-A14929
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Envelope glycoprotein D, gD, gD, US6, Human herpes simplex virus 2 (HSV-2), Human herpesvirus 2 (strain 333), Human herpes simplex virus 2, HHV-2
Target species Anti-Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2) Monoclonal Antibody

SDS-PAGE for Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

SDS-PAGE for Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365) binds to Recombinant HSV-2 gD/US6, N-GST in ELISA Assay

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365) binds to Recombinant HSV-2 gD/US6, N-GST in ELISA Assay

Recombinant HSV-2 gD/US6, N-GST(cat. No.ARO-P12850) at 0.5µg/mL (100µL/well) can bind Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

There are no reviews yet.

Be the first to review “Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products