Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)

Note:
For research use only. Not suitable for human use.

€380.00

100ug + 380 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)
Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)

Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)

Product name Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)
Uniprot ID P0AA25
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Escherichia coli (strain K12)
Aliases /Synonyms anti-Thioredoxin 1, anti-Trx-1, anti-trxA, anti-fipA, anti-tsnC, anti-b3781, anti-JW5856
Reference ARO-A16249
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen trxA/Thioredoxin
Clone Name SAA1139
Target species Anti-Escherichia coli (strain K12) Monoclonal Antibody

SDS-PAGE for Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)

SDS-PAGE for Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)

Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)

There are no reviews yet.

Be the first to review “Anti-Escherichia coli trxA/Thioredoxin VHH (SAA1139)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products