Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662)

  • ARO-A18920-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
VHH-hFc

Original price was: €368.00.Current price is: €265.00.

50ug 28% OFF + 265 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) binds to Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His in ELISA Assay

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662)

Product name ARO-A18920-100
Uniprot ID P03205
Raw Antigen Sequence MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-GP42, Anti-Glycoprotein 42
Isotype VHH-hFc
Clonality Monoclonal Antibody
Protein Name GP42
Product name ARO-A18920-1MG
Uniprot ID P03205
Raw Antigen Sequence MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-GP42, Anti-Glycoprotein 42
Isotype VHH-hFc
Clonality Monoclonal Antibody
Protein Name GP42
Product name ARO-A18920-50
Uniprot ID P03205
Raw Antigen Sequence MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-GP42, Anti-Glycoprotein 42
Isotype VHH-hFc
Clonality Monoclonal Antibody
Protein Name GP42

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) binds to Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His in ELISA Assay

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) binds to Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His in ELISA Assay

Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His(cat. No.ARO-P15674) at 0.5µg/mL (100µL/well) can bind Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products