Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-CD235a/GYPA Polyclonal Antibody

  • PTX20638-50
  • Validated WB

Original price was: €149.00.Current price is: €118.00.

50ug 21% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-CD235a/GYPA Polyclonal Antibody

Product name PTX20638-100
Uniprot ID P02724
Raw Antigen Sequence SALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD235a, GYPA, GPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD235a/GYPA
Format Liquid
Product name PTX20638-1MG
Uniprot ID P02724
Raw Antigen Sequence SALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD235a, GYPA, GPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD235a/GYPA
Format Liquid
Product name PTX20638-50
Uniprot ID P02724
Raw Antigen Sequence SALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD235a, GYPA, GPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD235a/GYPA
Format Liquid

Anti-Human CD235a/GYPA Polyclonal Antibody binds to Recombinant Human CD235a/GYPA Protein, N-His-KSI in WB Assay

Anti-Human CD235a/GYPA Polyclonal Antibody binds to Recombinant Human CD235a/GYPA Protein, N-His-KSI in WB Assay

Recombinant Human CD235a/GYPA Protein, N-His-KSI(cat. No.ARO-P10228) can bind Anti-Human CD235a/GYPA Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-CD235a/GYPA Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products