Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Bovine CYCS/CYC Antibody (SAA1419)

Original price was: €359.00.Current price is: €272.00.

50ug 24% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Bovine CYCS/CYC Antibody (SAA1419)

Product name ARO-A15355-100
Uniprot ID P62894
Raw Antigen Sequence MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Bovine
Reference ARO-A15355
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CYCS/CYC
Clone Name SAA1419
Protein Name CYCS/CYC
Target species Anti-Bovine Monoclonal Antibody
Product name ARO-A15355-1MG
Uniprot ID P62894
Raw Antigen Sequence MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Bovine
Reference ARO-A15355
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CYCS/CYC
Clone Name SAA1419
Protein Name CYCS/CYC
Target species Anti-Bovine Monoclonal Antibody
Product name ARO-A15355-50
Uniprot ID P62894
Raw Antigen Sequence MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Bovine
Reference ARO-A15355
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CYCS/CYC
Clone Name SAA1419
Protein Name CYCS/CYC
Target species Anti-Bovine Monoclonal Antibody

SDS-PAGE for Anti-Bovine CYCS/CYC Antibody (SAA1419)

SDS-PAGE for Anti-Bovine CYCS/CYC Antibody (SAA1419)

Anti-Bovine CYCS/CYC Antibody (SAA1419), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Bovine CYCS/CYC Antibody (SAA1419)

There are no reviews yet.

Be the first to review “Anti-Bovine CYCS/CYC Antibody (SAA1419)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products