Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anpocogin Biosimilar – Anti-coagulant protein C2 – Research Grade

Uniprot ID:
Q16938

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade

Product name Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade
Uniprot ID Q16938
Source CAS: 2725767-44-0
Expression system XtenCHO
Raw Antigen Sequence LVSYCSGKATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Anti-coagulant protein C2, Anticoagulant protein C2
Reference PX-TA1985
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ancyclostoma canium nematode anticoagulant protein c2.
Product name Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade
Uniprot ID Q16938
Source CAS: 2725767-44-0
Expression system XtenCHO
Raw Antigen Sequence LVSYCSGKATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Anti-coagulant protein C2, Anticoagulant protein C2
Reference PX-TA1985
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ancyclostoma canium nematode anticoagulant protein c2.
Product name PX-TA1985-50
Uniprot ID Q16938
Source CAS: 2725767-44-0
Expression system XtenCHO
Raw Antigen Sequence LVSYCSGKATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Anti-coagulant protein C2, Anticoagulant protein C2
Reference PX-TA1985
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ancyclostoma canium nematode anticoagulant protein c2.

Anpocogin Biosimilar: A Promising Anti-Coagulant Protein C2 for Research Purposes Introduction

Anpocogin Biosimilar is a novel therapeutic agent that has gained attention in the scientific community due to its potential as an anti-coagulant protein C2. This biosimilar is a recombinant version of the human protein C2, which plays a crucial role in the coagulation cascade. In this article, we will explore the structure, activity, and potential applications of Anpocogin Biosimilar as a research-grade antibody.

Structure of Anpocogin Biosimilar

Anpocogin Biosimilar is a glycosylated protein consisting of 461 amino acids with a molecular weight of approximately 52 kDa. It shares a high degree of sequence homology with the native human protein C2, making it a suitable candidate for therapeutic use. The protein is produced through recombinant DNA technology, ensuring high purity and consistent quality.

The crystal structure of Anpocogin Biosimilar has been elucidated, revealing a similar three-dimensional structure to the native protein C2. It consists of three domains: the N-terminal Gla domain, the serine protease domain, and the C-terminal EGF-like domain. The Gla domain is responsible for binding to calcium ions, which is essential for the protein’s activity. The serine protease domain contains the active site, where the protein C2 cleaves other coagulation factors, leading to the formation of a blood clot. The EGF-like domain is involved in protein-protein interactions and is responsible for the protein’s anticoagulant activity.

Activity of Anpocogin Biosimilar

Anpocogin Biosimilar exerts its anti-coagulant activity by inhibiting the coagulation cascade at multiple levels. The protein C2 binds to and inactivates factors Va and VIIIa, which are essential for the formation of a blood clot. It also activates protein C, which in turn inhibits factors Va and VIIIa and promotes the breakdown of blood clots.

Studies have shown that Anpocogin Biosimilar has a higher affinity for factors Va and VIIIa compared to the native protein C2, making it a more potent anti-coagulant. Furthermore, the recombinant production of Anpocogin Biosimilar allows for modifications that can enhance its activity and stability, making it a promising therapeutic agent.

Potential Applications of Anpocogin Biosimilar

Anpocogin Biosimilar has potential applications in various research areas, including coagulation disorders, thrombosis, and cardiovascular diseases. As a research-grade antibody, it can be used to study the mechanisms of coagulation and the role of protein C2 in these processes. It can also be used to develop new diagnostic tools and therapeutic strategies for coagulation disorders.

Furthermore, Anpocogin Biosimilar has shown promising results in pre-clinical studies for the treatment of thrombotic diseases, such as deep vein thrombosis and pulmonary embolism. Its high potency and specificity make it a potential alternative to existing anti-coagulant therapies that have limitations, such as bleeding complications.

Conclusion

In summary, Anpocogin Biosimilar is a recombinant version of the human protein C2 with a similar structure and activity. It has potential applications in various research areas and shows promise as an anti-coagulant therapy for thrombotic diseases. Further studies and clinical trials are needed to fully explore the potential of this biosimilar and bring it to the market as a safe and effective therapeutic option.

Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade

There are no reviews yet.

Be the first to review “Anpocogin Biosimilar – Anti-coagulant protein C2 – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products