Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

5′-AMP-activated protein kinase catalytic subunit alpha-1(PRKAA1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q13131
Molecular weight:
62.82 kDa

€210.00

50ug + 210 loyalty points
Met10–Gln559 N terminus His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
5'-AMP-activated protein kinase catalytic subunit alpha-1(PRKAA1)

5'-AMP-activated protein kinase catalytic subunit alpha-1(PRKAA1)

Product name 5'-AMP-activated protein kinase catalytic subunit alpha-1(PRKAA1)
Uniprot ID Q13131
Uniprot link https://www.uniprot.org/uniprot/Q13131
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKL FRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKP ENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSST MIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTR PHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPY YLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQ GKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Molecular weight 62.82 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >80% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met10-Gln559
Protein Accession Q13131
Spec:Entrez GeneID 5562
Spec:NCBI Gene Aliases AMPK; AMPKa1
Spec:SwissProtID Q9UNQ4
NCBI Reference Q13131
Aliases /Synonyms AMPK1,AMPK subunit alpha-1
Reference PX-P4805
Note For research use only
Molecular Constructor
Met10–Gln559 N terminus His
Product name 5'-AMP-activated protein kinase catalytic subunit alpha-1(PRKAA1)
Uniprot ID Q13131
Uniprot link https://www.uniprot.org/uniprot/Q13131
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKL FRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKP ENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSST MIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTR PHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPY YLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQ GKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Molecular weight 62.82 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >80% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met10-Gln559
Protein Accession Q13131
Spec:Entrez GeneID 5562
Spec:NCBI Gene Aliases AMPK; AMPKa1
Spec:SwissProtID Q9UNQ4
NCBI Reference Q13131
Aliases /Synonyms AMPK1,AMPK subunit alpha-1
Reference PX-P4805
Note For research use only
Molecular Constructor
Met10–Gln559 N terminus His

There are no reviews yet.

Be the first to review “5′-AMP-activated protein kinase catalytic subunit alpha-1(PRKAA1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products