Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Zika ZGE Recombinant Protein-Genome polyprotein |
|---|---|
| Uniprot ID | A0A140E7U5 |
| Uniprot link | http://www.uniprot.org/uniprot/A0A140E7U5 |
| Origin species | Zika |
| Expression system | Prokaryotic expression |
| Sequence | MIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTAMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMLVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLAHKEWFHDIPLPWHAGAATGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETVDGTVTVEGQYGGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIIGAAFKLEHHHHHH |
| Molecular weight | 54.6 kDa |
| Purity estimated | 85% |
| Buffer | PBS,pH7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Aliases /Synonyms | ZGE, Genome polyprotein |
| Reference | PX-P3065 |
| Note | For research use only |
The genome of Zika virus encodes a single polyprotein that is co- and post-translationally cleaved to generate 13 proteins. For example the peptide pr prevents premature fusion activity of envelope proteins in trans Golgi by binding to envelope protein E at pH6.0. After virion release in extracellular space gets dissociated from E dimers. Non-structural protein 4A induces host endoplasmic regulate the ATPase activity of the NS3 helicase. Non-structural protein 1 is implicated in immune evasion, pathogenesis and viral replication. Once cleaved off the polyprotein is targeted to three destinations: the viral replication cycle, the plasma membrane and the extracellular compartment. It may play a role in viral genome replication etc.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.