Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Urtoxazumab Biosimilar – Anti-Stx-2, SLT-II mAb – Research Grade

  • PX-TA1190-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade

Product name Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade
Uniprot ID Q07871
Source CAS 502496-16-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Urtoxazumab,HuVTm1.1,TMA-15,Stx-2, SLT-II,anti-Stx-2, SLT-II
Reference PX-TA1190
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade
Uniprot ID Q07871
Source CAS 502496-16-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Urtoxazumab,HuVTm1.1,TMA-15,Stx-2, SLT-II,anti-Stx-2, SLT-II
Reference PX-TA1190
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1190-50
Uniprot ID Q07871
Source CAS 502496-16-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Urtoxazumab,HuVTm1.1,TMA-15,Stx-2, SLT-II,anti-Stx-2, SLT-II
Reference PX-TA1190
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Urtoxazumab Biosimilar – Anti-Stx-2, SLT-II mAb – Research Grade is a monoclonal antibody that has been developed as a biosimilar to Urtoxazumab, a therapeutic antibody used in the treatment of Shiga toxin-producing E. coli (STEC) infections. This biosimilar has been designed to specifically target Stx-2, one of the main toxins produced by STEC, making it a promising therapeutic option for patients with STEC infections.

Structure of Urtoxazumab Biosimilar

Urtoxazumab Biosimilar is a monoclonal antibody, meaning it is produced by a single type of immune cell and is therefore highly specific in its target binding. The antibody is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains contain a variable region, responsible for binding to the target, and a constant region, which determines the antibody’s class and effector functions. The light chains also have a variable and constant region, but are smaller in size compared to the heavy chains.

Activity of Urtoxazumab Biosimilar

The main activity of Urtoxazumab Biosimilar is to bind to Stx-2, preventing it from binding to its target receptors on host cells. Stx-2 is a potent toxin produced by STEC, which can cause severe gastrointestinal and neurological symptoms in infected individuals. By binding to Stx-2, Urtoxazumab Biosimilar prevents the toxin from entering host cells and causing damage. This neutralizing activity of the biosimilar can help in reducing the severity of symptoms and improving the outcome of STEC infections.

In addition to its neutralizing activity, Urtoxazumab Biosimilar also has effector functions that can help in clearing Stx-2 from the body. These include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). In ADCC, the antibody binds to Stx-2 and recruits immune cells, such as natural killer cells, to destroy the target. In CDC, the antibody binds to Stx-2 and activates the complement system, leading to the lysis of the target.

Application of Urtoxazumab Biosimilar

Urtoxazumab Biosimilar has shown promising results in preclinical studies as a potential treatment for STEC infections. Its specificity and neutralizing activity make it a promising alternative to Urtoxazumab, which has shown limited efficacy in clinical trials. The biosimilar can also be used as a prophylactic treatment for individuals at high risk of STEC infections, such as those with compromised immune systems.

In addition to its therapeutic potential, Urtoxazumab Biosimilar can also be a valuable tool in research and diagnostics. Its specificity for Stx-2 makes it a useful reagent for detecting and quantifying the toxin in clinical samples. It can also be used in research studies to better understand the mechanisms of STEC infections and develop new treatments.

Conclusion

In summary, Urtoxazumab Biosimilar – Anti-Stx-2, SLT-II mAb – Research Grade is a monoclonal antibody that specifically targets Stx-2, a toxin produced by STEC. Its structure, activity, and applications make it a promising therapeutic option for STEC infections, as well as a valuable tool in research and diagnostics. Further clinical trials are needed to evaluate the efficacy and safety of this biosimilar, but it holds great potential in improving the treatment and prevention of STEC infections.

SEC-HPLC of Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

SEC-HPLC of Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

SDS-PAGE for Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade

Urtoxazumab Biosimilar - Anti-shiga toxin type 2stx2B mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Urtoxazumab Biosimilar - Anti-Stx-2, SLT-II mAb - Research Grade

There are no reviews yet.

Be the first to review “Urtoxazumab Biosimilar – Anti-Stx-2, SLT-II mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products