Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Tumor necrosis factor receptor superfamily member 19L(Relt) |
---|---|
Uniprot ID | Q8BX43 |
Uniprot link | https://www.uniprot.org/uniprot/Q8BX43 |
Expression system | Eukaryotic expression |
Sequence | MSLQGLMMKRTLLCWPLSCLFVLLPWPLATPTPITPWLCPPGKEPDPDPGQGTLCRTCPPGTFSASWNSYPCQPHYRCSLQKRLEAQAGTATHDTMCGDCQHGWFGPQGVPHVPCQPCSKAPPSTGGCDESGRGGGRGVEVAAGTSSNGEPRQPGNGTRAGGPEETAMVRSPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKHHHHHH |
Molecular weight | 41.56kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS, pH 7.5. |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Ala167(Arg134Gly,Arg136Gly) |
Protein Accession | Q8BX43 |
Spec:Entrez GeneID | 320100 |
Spec:NCBI Gene Aliases | Tnfrs; Tnfrsf19l; E430021K24Rik |
Spec:SwissProtID | Q497Z8 |
NCBI Reference | Q8BX43 |
Aliases /Synonyms | Tnfrsf19l |
Reference | PX-P4750 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.