Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein |
|---|---|
| Uniprot ID | P13403 |
| Uniprot link | http://www.uniprot.org/uniprot/P13403 |
| Origin species | Toxoplasma gondii |
| Expression system | Prokaryotic expression |
| Sequence | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH |
| Molecular weight | 22,92 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | >95% |
| Buffer | PBS, imidazole 300mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | P13403.1 |
| Spec:SwissProtID | P13403 |
| NCBI Reference | P13403.1 |
| Aliases /Synonyms | GRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1 |
| Reference | PX-P1093 |
| Note | For research use only |
Dense granules are specific secretory organelles. Dense granule protein 1 (GRA1) of Toxoplasma gondii is located in the dense granules of two forms: tachyzoite and bradyzoite. It has an immunoprophylactic interest in toxoplasmosis.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.