Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameToxoplasma gondii GRA1(25-190)(RH) Recombinant Protein
Uniprot IDP13403
Uniprot linkhttp://www.uniprot.org/uniprot/P13403
Origin speciesToxoplasma gondii
Expression systemProkaryotic expression
SequenceMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH
Molecular weight22,92 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionP13403.1
Spec:SwissProtIDP13403
NCBI ReferenceP13403.1
Aliases /SynonymsGRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1
ReferencePX-P1093
NoteFor research use only

Description of Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

General information on Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein:

Dense granules are specific secretory organelles. Dense granule protein 1 (GRA1) of Toxoplasma gondii is located in the dense granules of two forms: tachyzoite and bradyzoite. It has an immunoprophylactic interest in toxoplasmosis.

Publication

1: Cesbron-Delauw MF, Guy B, Torpier G, Pierce RJ, Lenzen G, Cesbron JY, Charif_x000D_ H, Lepage P, Darcy F, Lecocq JP, et al. Molecular characterization of a_x000D_ 23-kilodalton major antigen secreted by Toxoplasma gondii. Proc Natl Acad Sci U S_x000D_ A. 1989 Oct;86(19):7537-41. PubMed PMID: 2798425; PubMed Central PMCID:_x000D_ PMC298100.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products