Brand: ProteoGenix

TGFA / TGF-alpha, N-GST, recombinant protein

PX-P5953
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P01135
Molecular weight:: 32.38 kDa

€319.00

100ug + 319 loyalty points

GST Val40–Ala89

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

TGFA / TGF-alpha, N-GST, recombinant protein

Product name	TGFA / TGF-alpha, N-GST, recombinant protein
Uniprot ID	P01135
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Molecular weight	32.38 kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val40-Ala89
Protein Accession	P01135
Reference	PX-P5953
Note	For research use only
Molecular Constructor	GST Val40–Ala89