Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tadocizumab Biosimilar – Anti-ITGA2B_ITGB3 mAb – Research Grade

  • PX-TA1069-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Fab-G1-kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade

Product name Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade
Uniprot ID P08514 & P05106
Source CAS 339086-80-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tadocizumab,C4G1,YM-337,ITGA2B_ITGB3,anti-ITGA2B_ITGB3
Reference PX-TA1069
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade
Uniprot ID P08514 & P05106
Source CAS 339086-80-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tadocizumab,C4G1,YM-337,ITGA2B_ITGB3,anti-ITGA2B_ITGB3
Reference PX-TA1069
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1069-50
Uniprot ID P08514 & P05106
Source CAS 339086-80-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tadocizumab,C4G1,YM-337,ITGA2B_ITGB3,anti-ITGA2B_ITGB3
Reference PX-TA1069
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody

Introduction

Tadocizumab Biosimilar, also known as Anti-ITGA2B_ITGB3 mAb, is a monoclonal antibody (mAb) that targets the integrin α2β3, a key receptor involved in platelet aggregation and clot formation. This biosimilar is a research grade antibody that has shown promising potential in the treatment of various diseases.

Structure of Tadocizumab Biosimilar

Tadocizumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the target integrin, while the constant regions determine the effector functions of the antibody.

Mechanism of Action

Tadocizumab Biosimilar binds to the α2β3 integrin on the surface of platelets, preventing its interaction with fibrinogen and other ligands. This blocks the formation of platelet aggregates and inhibits the activation of platelets, ultimately leading to a reduction in blood clot formation. Additionally, the antibody may also induce apoptosis in activated platelets, further reducing their pro-thrombotic effects.

Therapeutic Applications

Tadocizumab Biosimilar has been studied for its potential use in various diseases where platelet aggregation and clot formation play a critical role. These include:

  • Thrombotic disorders: Tadocizumab Biosimilar has shown promising results in the treatment of thrombotic disorders such as acute coronary syndrome, stroke, and deep vein thrombosis. By inhibiting platelet aggregation, the antibody can prevent the formation of blood clots and reduce the risk of thrombosis.
  • Autoimmune diseases: The α2β3 integrin has been implicated in the pathogenesis of autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. Tadocizumab Biosimilar has shown potential in preclinical studies as a therapeutic agent for these conditions by targeting the integrin and reducing inflammation.
  • Cancer: Integrins play a crucial role in tumor growth, invasion, and metastasis. Tadocizumab Biosimilar has been investigated as a potential treatment for various cancers, including breast, lung, and colon cancer. By blocking the α2β3 integrin, the antibody may inhibit tumor growth and metastasis.

Research Grade Antibody

Tadocizumab Biosimilar is currently available as a research grade antibody, meaning it is intended for use in laboratory research and not for clinical use. It is produced using recombinant DNA technology and undergoes rigorous quality control measures to ensure its purity and potency.

Conclusion

Tadocizumab Biosimilar, also known as Anti-ITGA2B_ITGB3 mAb, is a promising monoclonal antibody targeting the α2β3 integrin. Its mechanism of action involves blocking platelet aggregation and reducing blood clot formation, making it a potential treatment for various diseases such as thrombotic disorders, autoimmune diseases, and cancer. As a research grade antibody, it has shown potential in preclinical studies and may pave the way for future clinical applications.

SDS-PAGE for Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade

SDS-PAGE for Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade in ELISA Assay

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade in ELISA Assay

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tadocizumab Biosimilar – Anti-ITGA2B_ITGB3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products