Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Synthetic construction GST 26-1 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Synthetic construction GST 26-1 Recombinant Protein |
|---|---|
| Uniprot ID | P08515 |
| Uniprot link | https://www.uniprot.org/uniprot/P08515 |
| Origin species | synthetic construction |
| Expression system | Prokaryotic expression |
| Sequence | MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE |
| Molecular weight | 39.38kDa |
| Purity estimated | 70% |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Spec:SwissProtID | P08515 |
| NCBI Reference | ABS19453 |
| Aliases /Synonyms | GST 26-1 (Sta1) |
| Reference | PX-P2092 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.