Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Stromal cell-derived factor 1(CXCL12)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Stromal cell-derived factor 1(CXCL12) |
|---|---|
| Uniprot ID | P48061 |
| Uniprot link | https://www.uniprot.org/uniprot/P48061 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Molecular weight | 8.1kDa |
| Protein delivered with Tag? | No tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS，pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Lys22-Lys89 |
| Protein Accession | P48061 |
| Spec:Entrez GeneID | 6387 |
| Spec:NCBI Gene Aliases | IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12 |
| Spec:SwissProtID | Q6ICW0 |
| NCBI Reference | P48061 |
| Aliases /Synonyms | SDF-1,hSDF-1,C-X-C motif chemokine 12,Intercrine reduced in hepatomas,IRH,hIRH,Pre-B cell growth-stimulating factor,PBSF,SDF1, SDF1A, SDF1B |
| Reference | PX-P4857 |
| Note | For research use only |
Related products
Polyclonal Antibody
CXCL12 / SDF-1 Polyclonal Polyclonal Antibody
PTX18549 169€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.