Skip to main content
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Slit homolog 2 protein(SLIT2)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameSlit homolog 2 protein(SLIT2)
Uniprot IDO94813
Uniprot linkhttp://www.uniprot.org/uniprot/O94813
Expression systemProkaryotic expression
SequenceMGKYLLPTAAAGLLLLAAQPAMALHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRR IDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKL QTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCGSHHHHHH
Molecular weight26.50kDa
Purity estimated>80% by SDS-PAGE
BufferPBS PH7.5, 4M urea 
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypeLeu271-Cys478
Aliases /SynonymsSLIL3,Slit-2
ReferencePX-P4478
NoteFor research use only

Description of Slit homolog 2 protein(SLIT2)

General Information about Slit homolog 2 protein

Slit2 is a member of the Slit family. It can send signals through the Roundabout (Robo) receptor and act as a repellent for axon guidance and neuronal migration. It can also act as a chemotactic factor for vascular endothelial cells and a chemotaxis inhibitor for white blood cells. Slit2 is mainly expressed in the lungs, kidneys and adult spinal cord of fetuses, but less in the adrenal glands, thyroid and trachea of ​​adults. Slit2 was originally synthesized as a precursor of 1499 amino acids, and then cleaved into N-terminal and C-terminal fragments, named Slit2-N and Slit2-C, respectively. As measured by the ability to reject olfactory bulb axons and induce branching in dorsal root ganglion axons, activities related to neurodevelopment are only contained in the N-terminal segment.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Slit homolog 2 protein(SLIT2)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products