Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Slit homolog 2 protein(SLIT2)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameSlit homolog 2 protein(SLIT2)
Uniprot IDO94813
Uniprot linkhttp://www.uniprot.org/uniprot/O94813
Expression systemProkaryotic expression
SequenceMGKYLLPTAAAGLLLLAAQPAMALHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRR IDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKL QTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCGSHHHHHH
Molecular weight26.50kDa
Purity estimated>80% by SDS-PAGE
BufferPBS PH7.5, 4M urea 
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeLeu271-Cys478
Aliases /SynonymsSLIL3,Slit-2
ReferencePX-P4478
NoteFor research use only

Description of Slit homolog 2 protein(SLIT2)

General Information about Slit homolog 2 protein

Slit2 is a member of the Slit family. It can send signals through the Roundabout (Robo) receptor and act as a repellent for axon guidance and neuronal migration. It can also act as a chemotactic factor for vascular endothelial cells and a chemotaxis inhibitor for white blood cells. Slit2 is mainly expressed in the lungs, kidneys and adult spinal cord of fetuses, but less in the adrenal glands, thyroid and trachea of ​​adults. Slit2 was originally synthesized as a precursor of 1499 amino acids, and then cleaved into N-terminal and C-terminal fragments, named Slit2-N and Slit2-C, respectively. As measured by the ability to reject olfactory bulb axons and induce branching in dorsal root ganglion axons, activities related to neurodevelopment are only contained in the N-terminal segment.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Slit homolog 2 protein(SLIT2)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products