Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Schistosoma GST Recombinant Protein |
|---|---|
| Origin species | Schistosoma |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLER PHRD |
| Molecular weight | 28,38 kDa |
| Protein delivered with Tag? | No |
| Purity estimated | >95% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | AAB37346.1 |
| NCBI Reference | AAB37346.1 |
| Aliases /Synonyms | GST, glutathione S-transferase |
| Reference | PX-P1103 |
| Note | For research use only |
Glutathione S-transferase (GST) is a 28 kDa enzyme initially found in Schistosoma japonicum, but presently isolated from a recombinant E. coli source. It catalyzes the extension of the glutathione thiol group to a suitable electrophilic species. Enzymatic activities are based on the conjugation of reduced glutathione in the presence of a second substrate.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.