Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Schistosoma GST Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameSchistosoma GST Recombinant Protein
Origin speciesSchistosoma
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLER PHRD
Molecular weight28,38 kDa
Protein delivered with Tag?No
Purity estimated>95%
BufferPBS, pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionAAB37346.1
NCBI ReferenceAAB37346.1
Aliases /SynonymsGST, glutathione S-transferase
ReferencePX-P1103
NoteFor research use only

Description of Schistosoma GST Recombinant Protein

General information on Schistosoma GST Recombinant Protein:

Glutathione S-transferase (GST) is a 28 kDa enzyme initially found in Schistosoma japonicum, but presently isolated from a recombinant E. coli source. It catalyzes the extension of the glutathione thiol group to a suitable electrophilic species. Enzymatic activities are based on the conjugation of reduced glutathione in the presence of a second substrate.

Publication

1: Smith DB, Johnson KS. Single-step purification of polypeptides expressed in_x000D_ Escherichia coli as fusions with glutathione S-transferase. Gene. 1988 Jul_x000D_ 15;67(1):31-40. PubMed PMID: 3047011._x000D_ _x000D_ _x000D_ 2: Cordingley MG, Callahan PL, Sardana VV, Garsky VM, Colonno RJ. Substrate_x000D_ requirements of human rhinovirus 3C protease for peptide cleavage in vitro. J_x000D_ Biol Chem. 1990 Jun 5;265(16):9062-5. PubMed PMID: 2160953.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Schistosoma GST Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products