Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Uniprot ID:
G3XD49
Molecular weight:
20.20 kDa

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Leu132–Ile294
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

Product name ARO-P10831-100
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706, Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reference ARO-P10831
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P10831-1MG
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706, Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reference ARO-P10831
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P10831-50
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706, Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reference ARO-P10831
Note For research use only.
Molecular Constructor
Leu132–Ile294

Introduction to Recombinant Pseudomonas aeruginosa PcrV Protein

Pseudomonas aeruginosa is a gram-negative bacterium that is commonly found in the environment and can cause infections in humans. One of the virulence factors of this bacterium is the PcrV protein, which is a key component of the type III secretion system (T3SS). This protein is essential for the bacterium to cause disease and has been identified as a potential target for vaccine development. In recent years, recombinant Pseudomonas aeruginosa PcrV protein has been extensively studied for its structure, activity, and application in various fields.

Structure of Recombinant Pseudomonas aeruginosa PcrV Protein

The PcrV protein is a highly conserved protein among different strains of Pseudomonas aeruginosa. It is a 33 kDa protein that is composed of 294 amino acids. The protein is divided into three domains: N-terminal, central, and C-terminal. The N-terminal domain is responsible for binding to the T3SS needle, while the central domain is involved in the formation of the T3SS translocon. The C-terminal domain is responsible for binding to the host cell receptor, which is crucial for the delivery of effector proteins into the host cell.

Recombinant Pseudomonas aeruginosa PcrV protein is produced by cloning the gene encoding for the protein into a suitable expression vector and then expressing it in a host organism such as Escherichia coli. The protein is then purified using various techniques such as affinity chromatography, ion exchange chromatography, and size exclusion chromatography. The purified protein is highly stable and retains its structural integrity, making it an ideal candidate for further studies.

Activity of Recombinant Pseudomonas aeruginosa PcrV Protein

The PcrV protein is a key component of the T3SS, which is a complex machinery used by Pseudomonas aeruginosa to inject effector proteins into host cells. The PcrV protein plays a crucial role in the assembly and function of the T3SS translocon, which is responsible for forming a pore in the host cell membrane for the delivery of effector proteins. Additionally, the PcrV protein also interacts with the host cell receptor, facilitating the delivery of effector proteins into the host cell.

Recombinant Pseudomonas aeruginosa PcrV protein has been shown to retain its activity and functionality, making it a valuable tool for studying the role of this protein in the pathogenesis of Pseudomonas aeruginosa. It has also been used in various in vitro and in vivo studies to understand the mechanism of action of the T3SS and to identify potential therapeutic targets.

Application of Recombinant Pseudomonas aeruginosa PcrV Protein

The PcrV protein has been identified as a potential vaccine candidate for Pseudomonas aeruginosa infections. Recombinant Pseudomonas aeruginosa PcrV protein has been used in various studies to develop vaccines that can induce a protective immune response against Pseudomonas aeruginosa infections. These vaccines have shown promising results in animal models and are currently being tested in clinical trials.

Apart from its potential as a vaccine candidate, recombinant Pseudomonas aeruginosa PcrV protein has also been used in the development of diagnostic tools for Pseudomonas aeruginosa infections. The protein has been used in immunoassays to detect the presence of Pseudomonas aeruginosa in clinical samples, providing a rapid and accurate method for diagnosis.

In addition, recombinant Pseudomonas aeruginosa PcrV protein has also been studied for its potential as a therapeutic target. Inhibitors targeting the PcrV protein have shown promising results in reducing the virulence of Pseudomonas aeruginosa and increasing the efficacy of antibiotics in treating infections caused by this bacterium.

Conclusion

In conclusion,

SDS-PAGE for Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

SDS-PAGE for Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Pseudomonas aeruginosa PcrV Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products