Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CDC42 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P60766
Molecular weight:
23 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Met1–Cys188
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CDC42 Protein, N-His

Product name ARO-P10925-100
Uniprot ID P60766
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular weight 23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Cys188
Aliases /Synonyms CDC42, G25K GTP-binding protein, Cell division control protein 42 homolog
Reference ARO-P10925
Note For research use only.
Molecular Constructor
Met1–Cys188
Product name ARO-P10925-1MG
Uniprot ID P60766
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular weight 23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Cys188
Aliases /Synonyms CDC42, G25K GTP-binding protein, Cell division control protein 42 homolog
Reference ARO-P10925
Note For research use only.
Molecular Constructor
Met1–Cys188
Product name ARO-P10925-50
Uniprot ID P60766
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular weight 23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Cys188
Aliases /Synonyms CDC42, G25K GTP-binding protein, Cell division control protein 42 homolog
Reference ARO-P10925
Note For research use only.
Molecular Constructor
Met1–Cys188

Introduction to Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein is a highly versatile and widely used protein in the field of molecular biology and biotechnology. It is a member of the Rho family of small GTPases and plays a crucial role in regulating various cellular processes such as cell division, cell migration, and cell polarity. In this article, we will delve into the structure, activity, and applications of this important protein.

Structure of Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein is a 21 kDa protein consisting of 191 amino acids. It is encoded by the Cdc42 gene and is highly conserved across different species. The protein structure consists of a central core domain, which is responsible for binding to GTP and GDP, and a switch I and switch II region, which undergo conformational changes upon GTP binding. The protein also contains a polybasic region and a C-terminal hypervariable region, which are involved in protein-protein interactions and membrane localization, respectively.

The crystal structure of Recombinant Mouse CDC42 Protein has been extensively studied and has provided insights into its functional mechanisms. The protein exists in two conformations, the active GTP-bound form and the inactive GDP-bound form. The active form is characterized by a conformational change in the switch I and switch II regions, resulting in the exposure of a hydrophobic pocket that allows for binding to downstream effector proteins.

Activity of Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein is a key regulator of various cellular processes, including cell division, cell migration, and cell polarity. It functions as a molecular switch, cycling between the active GTP-bound form and the inactive GDP-bound form. The activation of the protein is tightly regulated by guanine nucleotide exchange factors (GEFs), which facilitate the exchange of GDP for GTP, and GTPase-activating proteins (GAPs), which accelerate the hydrolysis of GTP to GDP. The balance between GEFs and GAPs controls the overall activity of Recombinant Mouse CDC42 Protein.

The active form of Recombinant Mouse CDC42 Protein interacts with a variety of downstream effector proteins, including kinases, phosphatases, and cytoskeletal proteins. These interactions lead to the activation of signaling pathways that regulate cell morphology, cytoskeletal dynamics, and gene expression. For example, the binding of Recombinant Mouse CDC42 Protein to the kinase PAK1 results in the activation of the MAPK/ERK pathway, which is involved in cell proliferation and survival.

Applications of Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein has a wide range of applications in both basic research and biotechnology. Its role as a key regulator of cellular processes makes it an important tool for studying cell signaling, cytoskeletal dynamics, and cell migration. In addition, Recombinant Mouse CDC42 Protein has been used in the development of various in vitro assays for drug screening and target validation.

One of the major applications of Recombinant Mouse CDC42 Protein is in the field of cancer research. Aberrant activation of CDC42 has been implicated in the development and progression of various types of cancer. Recombinant Mouse CDC42 Protein has been used to study the role of CDC42 in cancer cell proliferation, invasion, and metastasis. In addition, it has been utilized in the development of potential anti-cancer drugs that target CDC42 signaling pathways.

Furthermore, Recombinant Mouse CDC42 Protein has been used in the production of recombinant vaccines. The protein has been shown to induce strong immune responses and has been used as an antigen in vaccine development against various infectious diseases. Its ability to stimulate both humoral and cellular immune responses makes it a promising candidate for the development of novel vaccines.

Conclusion

In

Recombinant Mouse CDC42 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CDC42 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products