Brand: ProteoGenix

Recombinant Mouse CD314/KLRK1/NKG2D Protein, N-His

ARO-P10836-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Mouse
Uniprot ID:: O54709
Molecular weight:: 19 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points

Phe90–Val232

Size Size

50ug Original price was: €271.00.Current price is: €230.00.
100ug Original price was: €411.00.Current price is: €329.00.
1MG Original price was: €1,164.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Mouse CD314/KLRK1/NKG2D Protein, N-His

Product name	ARO-P10836-100
Uniprot ID	O54709
Origin species	Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Molecular weight	19 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe90-Val232
Aliases /Synonyms	NKG2-D type II integral membrane protein, Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2-D-activating NK receptor, CD314, Klrk1, Nkg2d
Reference	ARO-P10836
Note	For research use only.
Molecular Constructor	Phe90–Val232

Product name	ARO-P10836-1MG
Uniprot ID	O54709
Origin species	Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Molecular weight	19 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe90-Val232
Aliases /Synonyms	NKG2-D type II integral membrane protein, Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2-D-activating NK receptor, CD314, Klrk1, Nkg2d
Reference	ARO-P10836
Note	For research use only.
Molecular Constructor	Phe90–Val232

Product name	ARO-P10836-50
Uniprot ID	O54709
Origin species	Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Molecular weight	19 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe90-Val232
Aliases /Synonyms	NKG2-D type II integral membrane protein, Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2-D-activating NK receptor, CD314, Klrk1, Nkg2d
Reference	ARO-P10836
Note	For research use only.
Molecular Constructor	Phe90–Val232