Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAD51AP1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96B01
Molecular weight:
17.45 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Arg70–Asn116
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAD51AP1 Protein, N-His-SUMO

Product name ARO-P11888-100
Uniprot ID Q96B01
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTN
Molecular weight 17.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg70-Asn116
Aliases /Synonyms PIR51, RAD51-interacting protein, RAD51-associated protein 1, RAD51AP1, HsRAD51AP1
Reference ARO-P11888
Note For research use only.
Molecular Constructor
Arg70–Asn116
Product name ARO-P11888-1MG
Uniprot ID Q96B01
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTN
Molecular weight 17.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg70-Asn116
Aliases /Synonyms PIR51, RAD51-interacting protein, RAD51-associated protein 1, RAD51AP1, HsRAD51AP1
Reference ARO-P11888
Note For research use only.
Molecular Constructor
Arg70–Asn116
Product name ARO-P11888-50
Uniprot ID Q96B01
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTN
Molecular weight 17.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg70-Asn116
Aliases /Synonyms PIR51, RAD51-interacting protein, RAD51-associated protein 1, RAD51AP1, HsRAD51AP1
Reference ARO-P11888
Note For research use only.
Molecular Constructor
Arg70–Asn116

Introduction

Recombinant Human RAD51AP1 Protein, also known as RAD51-associated protein 1, is a protein that plays a crucial role in DNA repair and maintenance. It is a key component of the homologous recombination pathway, which is responsible for repairing double-stranded DNA breaks. RAD51AP1 is essential for the proper functioning of this pathway and its absence can lead to genomic instability and increased susceptibility to cancer.

Structure

The RAD51AP1 protein is encoded by the RAD51AP1 gene located on chromosome 12 in humans. It consists of 332 amino acids with a molecular weight of approximately 38 kDa. The protein contains several domains, including a conserved N-terminal domain, a central coiled-coil domain, and a C-terminal domain. These domains are essential for the protein’s function in DNA repair.

Activity

RAD51AP1 plays a crucial role in the homologous recombination pathway by interacting with the RAD51 protein, which is responsible for the strand invasion step during DNA repair. RAD51AP1 acts as a mediator protein, facilitating the assembly of RAD51 filaments on single-stranded DNA at the site of a DNA break. This promotes the search for a homologous DNA template and the formation of a stable joint molecule, leading to successful DNA repair.

In addition to its role in DNA repair, RAD51AP1 has also been shown to play a role in telomere maintenance, which is essential for chromosome stability and cell survival. It interacts with telomeric proteins and promotes the formation of telomeric DNA loops, which are crucial for telomere protection and regulation of telomerase activity.

Application

The recombinant form of RAD51AP1 protein has been widely used in various research applications, including studies on DNA repair mechanisms and telomere maintenance. It has also been used in drug discovery and development for cancer treatment, as RAD51AP1 is overexpressed in many cancer cells and its inhibition can sensitize cancer cells to DNA-damaging agents.

Furthermore, RAD51AP1 has been identified as a potential biomarker for cancer diagnosis and prognosis. Its overexpression has been linked to poor outcomes in various types of cancer, making it a promising target for personalized cancer therapy.

Conclusion

In summary, Recombinant Human RAD51AP1 Protein is a crucial component of the homologous recombination pathway and plays a significant role in DNA repair and telomere maintenance. Its structure, activity, and application have been extensively studied, and its potential as a biomarker and therapeutic target for cancer treatment is being explored. Further research on this protein will provide a better understanding of its role in DNA repair and its potential implications in disease development and treatment.

Recombinant Human RAD51AP1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human RAD51AP1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products