Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PSMB1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20618
Molecular weight:
24.78 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Gly38–Asp241
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PSMB1 Protein, N-His

Product name ARO-P12210-100
Uniprot ID P20618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Molecular weight 24.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly38-Asp241
Aliases /Synonyms PSMB1, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome gamma chain, Proteasome subunit beta type-1, PSC5, Proteasome component C5
Reference ARO-P12210
Note For research use only.
Molecular Constructor
Gly38–Asp241
Product name ARO-P12210-1MG
Uniprot ID P20618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Molecular weight 24.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly38-Asp241
Aliases /Synonyms PSMB1, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome gamma chain, Proteasome subunit beta type-1, PSC5, Proteasome component C5
Reference ARO-P12210
Note For research use only.
Molecular Constructor
Gly38–Asp241
Product name ARO-P12210-50
Uniprot ID P20618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Molecular weight 24.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly38-Asp241
Aliases /Synonyms PSMB1, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome gamma chain, Proteasome subunit beta type-1, PSC5, Proteasome component C5
Reference ARO-P12210
Note For research use only.
Molecular Constructor
Gly38–Asp241

Introduction to Recombinant Human PSMB1 Protein

Recombinant Human PSMB1 Protein, also known as Proteasome Subunit Beta Type-1 or PSMB1, is a protein that plays a crucial role in the degradation of intracellular proteins. It is a subunit of the 20S proteasome, a large protein complex responsible for the degradation of damaged or misfolded proteins, as well as the regulation of key cellular processes such as cell cycle progression and immune response.

Structure of Recombinant Human PSMB1 Protein

The human PSMB1 gene is located on chromosome 6 and contains 9 exons, which undergo alternative splicing to produce two isoforms of the protein. The full-length isoform, PSMB1-α, is 264 amino acids long, while the shorter isoform, PSMB1-β, is 250 amino acids long. Both isoforms have a molecular weight of approximately 29 kDa.

The crystal structure of recombinant human PSMB1 protein has been determined, revealing a four-layered αββα sandwich fold. The protein contains seven β-strands and six α-helices, with a central cavity that serves as the active site for protein degradation. The N-terminal region of the protein contains a proline-rich loop, which is involved in protein-protein interactions within the proteasome complex.

Activity of Recombinant Human PSMB1 Protein

Recombinant Human PSMB1 Protein is an essential component of the 20S proteasome, where it acts as a catalytic subunit. The 20S proteasome is composed of four stacked rings, with two outer rings containing seven α-subunits and two inner rings containing seven β-subunits. PSMB1 is one of the three β-subunits responsible for the proteasome’s peptidase activity, along with PSMB2 and PSMB5.

The peptidase activity of the 20S proteasome is essential for the degradation of proteins tagged with ubiquitin, a process known as ubiquitin-proteasome pathway. This pathway plays a crucial role in maintaining cellular homeostasis by eliminating misfolded or damaged proteins, as well as regulating the levels of key proteins involved in cell signaling and immune response.

In addition to its role in protein degradation, recombinant human PSMB1 protein has been shown to have non-proteolytic functions. Studies have demonstrated that PSMB1 can interact with other proteins to regulate key cellular processes, such as cell cycle progression and DNA repair.

Applications of Recombinant Human PSMB1 Protein

The unique structure and activity of recombinant human PSMB1 protein make it an essential tool in various biological and medical applications. The protein is commonly used in research to study the role of the proteasome in cellular processes and to investigate the mechanisms of protein degradation. Recombinant PSMB1 protein is also used in drug discovery and development, as the proteasome has emerged as an attractive target for the treatment of various diseases, including cancer and neurodegenerative disorders.

Furthermore, recombinant human PSMB1 protein has potential diagnostic and therapeutic applications. Studies have shown that the levels of PSMB1 are altered in various diseases, such as Alzheimer’s disease and multiple myeloma, making it a potential biomarker for disease diagnosis and prognosis. In addition, recombinant PSMB1 protein has been used in clinical trials as a potential therapeutic agent for the treatment of autoimmune diseases and cancer.

Conclusion

In summary, recombinant human PSMB1 protein is a crucial component of the 20S proteasome, with essential roles in protein degradation and cellular processes regulation. Its unique structure and activity make it a valuable tool in various research and medical applications. Further studies on the protein’s functions and potential therapeutic applications may lead to new

Recombinant Human PSMB1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PSMB1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products