Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLA1A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53H76
Molecular weight:
18.55 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Leu309–Lys452
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLA1A, N-His

Product name ARO-P13312-100
Uniprot ID Q53H76
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu309-Lys452
Aliases /Synonyms PSPLA1, PS-PLA1, Phosphatidylserine-specific phospholipase A1, PLA1A, NMD, Phospholipase A1 member A
Reference ARO-P13312
Note For research use only.
Molecular Constructor
Leu309–Lys452
Product name ARO-P13312-1MG
Uniprot ID Q53H76
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu309-Lys452
Aliases /Synonyms PSPLA1, PS-PLA1, Phosphatidylserine-specific phospholipase A1, PLA1A, NMD, Phospholipase A1 member A
Reference ARO-P13312
Note For research use only.
Molecular Constructor
Leu309–Lys452
Product name ARO-P13312-50
Uniprot ID Q53H76
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu309-Lys452
Aliases /Synonyms PSPLA1, PS-PLA1, Phosphatidylserine-specific phospholipase A1, PLA1A, NMD, Phospholipase A1 member A
Reference ARO-P13312
Note For research use only.
Molecular Constructor
Leu309–Lys452

Recombinant Human PLA1A: Structure, Activity, and Application

Introduction

Recombinant proteins are proteins that are produced in a laboratory setting through genetic engineering techniques. These proteins have become essential tools in various fields of research, including medicine, biotechnology, and agriculture. One such recombinant protein is Recombinant Human PLA1A, which has gained significant attention due to its unique structure, activity, and potential applications. In this article, we will explore the structure, activity, and application of this recombinant protein in detail.

Structure of Recombinant Human PLA1A

Recombinant Human PLA1A is a member of the phospholipase A1 (PLA1) family of enzymes. It is a 55 kDa protein that is composed of 486 amino acids. The gene encoding this protein is located on chromosome 2 in humans and is highly conserved among different species. The recombinant protein is produced by cloning the gene into a suitable expression vector and then expressing it in a host organism, such as bacteria or yeast.

The crystal structure of Recombinant Human PLA1A has been determined, revealing a unique three-dimensional structure. It consists of a central core domain, which is responsible for the catalytic activity of the enzyme, and two peripheral domains, which are involved in substrate binding. The central core domain contains a catalytic triad of amino acids (Ser-Asp-His) that is essential for the enzymatic activity of PLA1A.

Activity of Recombinant Human PLA1A

PLA1A enzymes are known for their ability to hydrolyze the ester bond between the sn-1 fatty acid and the glycerol backbone of phospholipids. Recombinant Human PLA1A exhibits this activity and is specific for phospholipids containing unsaturated fatty acids at the sn-1 position. It has been shown to have a preference for phosphatidylcholine and phosphatidylethanolamine as substrates.

The enzymatic activity of Recombinant Human PLA1A has been extensively studied, and it has been shown to play a crucial role in various physiological processes. It is involved in the remodeling of cell membranes, which is essential for maintaining their fluidity and integrity. It also plays a role in lipid metabolism, inflammation, and immune response.

Application of Recombinant Human PLA1A

The unique structure and activity of Recombinant Human PLA1A make it a valuable tool in various research areas. One of its primary applications is in drug discovery and development. The role of PLA1A in inflammation and immune response makes it a potential target for the treatment of various diseases, such as atherosclerosis, cancer, and autoimmune disorders. Recombinant Human PLA1A can be used to screen potential inhibitors or activators of this enzyme, which can then be further developed into therapeutic agents.

Another potential application of Recombinant Human PLA1A is in the production of transgenic crops. The enzyme is involved in the synthesis of phospholipids, which are essential components of plant cell membranes. By overexpressing the gene encoding PLA1A in plants, researchers can potentially enhance the production of phospholipids, leading to improved plant growth and yield.

Conclusion

Recombinant Human PLA1A is a unique and versatile enzyme with a wide range of potential applications. Its structure and activity make it an essential tool in drug discovery, biotechnology, and agriculture. As research on this enzyme continues, we can expect to uncover more of its functions and potential applications, further highlighting its importance in the scientific community.

Recombinant Human PLA1A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLA1A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products