Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PITRM1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5JRX3
Molecular weight:
31.74 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Leu544–Ser806
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PITRM1, N-His

Product name ARO-P13307-100
Uniprot ID Q5JRX3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Molecular weight 31.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu544-Ser806
Aliases /Synonyms Pitrilysin metalloproteinase 1, hMP1, MP1, Metalloprotease 1, PREP, KIAA1104, Presequence protease, mitochondrial, PITRM1, hPreP
Reference ARO-P13307
Note For research use only.
Molecular Constructor
Leu544–Ser806
Product name ARO-P13307-1MG
Uniprot ID Q5JRX3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Molecular weight 31.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu544-Ser806
Aliases /Synonyms Pitrilysin metalloproteinase 1, hMP1, MP1, Metalloprotease 1, PREP, KIAA1104, Presequence protease, mitochondrial, PITRM1, hPreP
Reference ARO-P13307
Note For research use only.
Molecular Constructor
Leu544–Ser806
Product name ARO-P13307-50
Uniprot ID Q5JRX3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Molecular weight 31.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu544-Ser806
Aliases /Synonyms Pitrilysin metalloproteinase 1, hMP1, MP1, Metalloprotease 1, PREP, KIAA1104, Presequence protease, mitochondrial, PITRM1, hPreP
Reference ARO-P13307
Note For research use only.
Molecular Constructor
Leu544–Ser806

Introduction

Recombinant Human PITRM1, also known as Presequence Protease, is a protein that plays a crucial role in the degradation of mitochondrial targeting peptides. It is a highly conserved protein found in various species including humans, mice, and rats. In this article, we will discuss the structure, activity, and applications of Recombinant Human PITRM1.

Structure of Recombinant Human PITRM1

Recombinant Human PITRM1 is a 101 kDa protein that consists of 912 amino acids. It is composed of two functional domains, the N-terminal presequence protease domain and the C-terminal peptidase M16 domain. The presequence protease domain is responsible for the cleavage of mitochondrial targeting peptides, while the peptidase M16 domain is involved in the degradation of longer peptides. The two domains are connected by a linker region that is important for the optimal functioning of the protein.

The crystal structure of Recombinant Human PITRM1 has been determined, revealing a unique arrangement of the two domains. The presequence protease domain forms a barrel-like structure, while the peptidase M16 domain has a globular shape. This structure allows for efficient substrate binding and catalysis.

Activity of Recombinant Human PITRM1

Recombinant Human PITRM1 is a metalloprotease that requires zinc ions for its activity. It is primarily located in the mitochondrial matrix, where it plays a critical role in maintaining mitochondrial homeostasis. The protein is responsible for the degradation of mitochondrial targeting peptides that are no longer needed after protein import into the mitochondria. It also degrades damaged proteins and prevents the accumulation of toxic peptides in the mitochondria.

Studies have shown that Recombinant Human PITRM1 has a broad substrate specificity, with the ability to cleave a variety of peptides of different lengths and sequences. It has a preference for peptides with basic and hydrophobic amino acids, which are commonly found in mitochondrial targeting sequences. The protein also has a high catalytic efficiency, making it a highly efficient protease in the mitochondria.

Applications of Recombinant Human PITRM1

Recombinant Human PITRM1 has various potential applications in both research and therapeutic settings. Its role in mitochondrial homeostasis makes it a crucial protein in understanding mitochondrial diseases and aging. Mutations in the gene encoding PITRM1 have been linked to neurodegenerative disorders, highlighting its importance in maintaining proper mitochondrial function.

In addition, Recombinant Human PITRM1 has been used in studies to investigate the role of mitochondrial targeting peptides in protein import and processing. Its ability to degrade peptides of different lengths and sequences makes it a valuable tool in studying the specificity and efficiency of mitochondrial protein import pathways.

Furthermore, Recombinant Human PITRM1 has potential therapeutic applications in the treatment of mitochondrial disorders. By targeting the protein, it may be possible to restore mitochondrial homeostasis and prevent the accumulation of toxic peptides in the mitochondria. This could potentially slow down the progression of neurodegenerative diseases and other disorders associated with mitochondrial dysfunction.

Conclusion

Recombinant Human PITRM1 is a crucial protein involved in the degradation of mitochondrial targeting peptides. Its unique structure and broad substrate specificity make it an efficient protease in maintaining mitochondrial homeostasis. Its role in mitochondrial diseases and aging, as well as its potential therapeutic applications, make it a promising protein for further research. With its diverse functions and potential implications, Recombinant Human PITRM1 is an important protein in the study of mitochondrial biology.

Recombinant Human PITRM1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PITRM1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products