Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PHPT1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRX4
Molecular weight:
16.14 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Met1–Tyr125
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PHPT1, N-His

Product name ARO-P13063-100
Uniprot ID Q9NRX4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Molecular weight 16.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr125
Aliases /Synonyms Protein histidine phosphatase, Protein janus-A homolog, PHPT1, PHP14, 14 kDa phosphohistidine phosphatase, PHP, Phosphohistidine phosphatase 1
Reference ARO-P13063
Note For research use only.
Molecular Constructor
Met1–Tyr125
Product name ARO-P13063-1MG
Uniprot ID Q9NRX4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Molecular weight 16.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr125
Aliases /Synonyms Protein histidine phosphatase, Protein janus-A homolog, PHPT1, PHP14, 14 kDa phosphohistidine phosphatase, PHP, Phosphohistidine phosphatase 1
Reference ARO-P13063
Note For research use only.
Molecular Constructor
Met1–Tyr125
Product name ARO-P13063-50
Uniprot ID Q9NRX4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Molecular weight 16.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr125
Aliases /Synonyms Protein histidine phosphatase, Protein janus-A homolog, PHPT1, PHP14, 14 kDa phosphohistidine phosphatase, PHP, Phosphohistidine phosphatase 1
Reference ARO-P13063
Note For research use only.
Molecular Constructor
Met1–Tyr125

The Structure of Recombinant Human PHPT1

Recombinant Human PHPT1 is a protein that plays an important role in cellular metabolism and has been extensively studied for its potential therapeutic applications. This protein is encoded by the PHPT1 gene and is a member of the phosphohistidine phosphatase family. It is composed of 149 amino acids and has a molecular weight of approximately 17 kilodaltons. The structure of Recombinant Human PHPT1 has been determined through X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy, revealing a highly conserved active site and a unique catalytic mechanism.

The Active Site of Recombinant Human PHPT1

The active site of Recombinant Human PHPT1 is located in a cleft between two domains, the N-terminal and C-terminal domains. This cleft contains a highly conserved catalytic triad consisting of a cysteine residue, a histidine residue, and an aspartate residue. The cysteine residue acts as a nucleophile, attacking the phosphate group of the substrate, while the histidine residue acts as a general acid/base, facilitating the transfer of a proton during the catalytic reaction. The aspartate residue helps to stabilize the transition state of the reaction.

The Catalytic Mechanism of Recombinant Human PHPT1

The catalytic mechanism of Recombinant Human PHPT1 involves the dephosphorylation of phosphohistidine residues in proteins. Phosphohistidine is a rare post-translational modification that plays a crucial role in cellular signaling and regulation. Recombinant Human PHPT1 specifically targets phosphohistidine residues and removes the phosphate group, converting them back to histidine residues. This dephosphorylation reaction is essential for maintaining proper cellular function and has been linked to various diseases, making Recombinant Human PHPT1 a potential therapeutic target.

The Role of Recombinant Human PHPT1 in Cellular Metabolism

Recombinant Human PHPT1 is involved in several metabolic pathways, including the regulation of glucose and lipid metabolism. It has been shown to play a role in insulin signaling, as well as in the breakdown of fatty acids. Additionally, Recombinant Human PHPT1 has been linked to the regulation of cell growth and proliferation, making it a potential target for cancer treatment.

Applications of Recombinant Human PHPT1

Recombinant Human PHPT1 has been extensively studied for its potential therapeutic applications. Due to its role in cellular metabolism and its involvement in various diseases, it has been identified as a potential target for drug development. Recombinant Human PHPT1 inhibitors have been developed and tested for their ability to treat diseases such as diabetes, obesity, and cancer. Additionally, Recombinant Human PHPT1 has been used as a tool in research to study the role of phosphohistidine in cellular signaling and regulation.

The Production of Recombinant Human PHPT1

Recombinant Human PHPT1 is produced through genetic engineering techniques, where the PHPT1 gene is inserted into a host organism, such as bacteria or yeast. The host organism then produces the Recombinant Human PHPT1 protein, which can be purified and used for various applications. This recombinant protein is highly pure and has been extensively characterized to ensure its quality and activity.

Conclusion

In summary, Recombinant Human PHPT1 is a protein with a highly conserved structure and a unique catalytic mechanism. It plays a crucial role in cellular metabolism and has been identified as a potential therapeutic target for various diseases. Its production through genetic engineering techniques has allowed for the development of Recombinant Human PHPT1 inhibitors and its use as a tool in research. Further studies on this protein will continue to shed light on its role in cellular function and its potential as a therapeutic agent.

Recombinant Human PHPT1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PHPT1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products