Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99732
Molecular weight:
35.80 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Ile92–Leu161
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His

Product name ARO-P11524-100
Uniprot ID Q99732
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Molecular weight 35.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile92-Leu161
Aliases /Synonyms Small integral membrane protein of lysosome/late endosome, LITAF, SIMPLE, p53-induced gene 7 protein, LPS-induced TNF-alpha factor, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, PIG7
Reference ARO-P11524
Note For research use only.
Molecular Constructor
Ile92–Leu161
Product name ARO-P11524-1MG
Uniprot ID Q99732
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Molecular weight 35.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile92-Leu161
Aliases /Synonyms Small integral membrane protein of lysosome/late endosome, LITAF, SIMPLE, p53-induced gene 7 protein, LPS-induced TNF-alpha factor, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, PIG7
Reference ARO-P11524
Note For research use only.
Molecular Constructor
Ile92–Leu161
Product name ARO-P11524-50
Uniprot ID Q99732
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Molecular weight 35.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile92-Leu161
Aliases /Synonyms Small integral membrane protein of lysosome/late endosome, LITAF, SIMPLE, p53-induced gene 7 protein, LPS-induced TNF-alpha factor, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, PIG7
Reference ARO-P11524
Note For research use only.
Molecular Constructor
Ile92–Leu161

Introduction to Recombinant Human LITAF/PIG7/SIMPLE Protein

Recombinant Human LITAF/PIG7/SIMPLE Protein, also known as Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF), Phosphatidylinositol glycan anchor biosynthesis class F protein (PIG7), or Small integral membrane protein of lysosome/late endosome (SIMPLE), is a protein that plays a crucial role in the immune response and cellular processes. This protein is encoded by the LITAF gene, located on chromosome 16 in humans. Recombinant Human LITAF/PIG7/SIMPLE Protein is produced using recombinant DNA technology, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human LITAF/PIG7/SIMPLE Protein

Recombinant Human LITAF/PIG7/SIMPLE Protein is a 161 amino acid protein with a molecular weight of approximately 18.5 kDa. It contains a single transmembrane domain and is predominantly localized in the endosomal and lysosomal compartments of the cell. The protein structure consists of an N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain is responsible for the protein’s interaction with other cellular proteins, while the central domain is involved in the regulation of cellular processes. The C-terminal domain is responsible for the protein’s transmembrane localization and is essential for its function.

Activity of Recombinant Human LITAF/PIG7/SIMPLE Protein

Recombinant Human LITAF/PIG7/SIMPLE Protein is primarily known for its role in the immune response. It is involved in the production of cytokines, such as tumor necrosis factor-alpha (TNF-α), which play a crucial role in inflammation and host defense against pathogens. The protein is also involved in the regulation of autophagy, a process that helps in the removal of damaged or unnecessary cellular components. Additionally, Recombinant Human LITAF/PIG7/SIMPLE Protein has been shown to play a role in lipid metabolism and cellular signaling pathways.

Recent studies have also suggested a potential role of Recombinant Human LITAF/PIG7/SIMPLE Protein in cancer. It has been shown to be upregulated in various types of cancer, and its overexpression has been linked to tumor growth and metastasis. Further research is needed to fully understand the role of this protein in cancer and its potential as a therapeutic target.

Application of Recombinant Human LITAF/PIG7/SIMPLE Protein

Recombinant Human LITAF/PIG7/SIMPLE Protein has various applications in both research and therapeutic settings. Its role in the immune response makes it a valuable tool for studying the mechanisms of inflammation and host defense against pathogens. It can also be used to investigate the role of autophagy in cellular processes and its potential as a therapeutic target in diseases such as neurodegenerative disorders and cancer.

In therapeutic applications, Recombinant Human LITAF/PIG7/SIMPLE Protein has shown promising results as a potential immunotherapy for cancer. Studies have demonstrated that the protein can induce an immune response against cancer cells and inhibit tumor growth. It has also been shown to enhance the effectiveness of other cancer treatments, such as chemotherapy and radiation therapy.

Furthermore, Recombinant Human LITAF/PIG7/SIMPLE Protein has potential as a diagnostic biomarker for various diseases. Its overexpression in certain types of cancer makes it a potential marker for early detection and monitoring of disease progression.

Conclusion

Recombinant Human LITAF/PIG7/SIMPLE Protein is a multifunctional protein with important roles in the immune response, cellular processes, and potentially cancer. Its

Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products