Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARCN1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P48444
Molecular weight:
29.18 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Ser273–Leu511
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARCN1 Protein, N-His

Product name ARO-P11794-100
Uniprot ID P48444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Molecular weight 29.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser273-Leu511
Aliases /Synonyms Delta-coat protein, Coatomer subunit delta, COPD, ARCN1, Archain, Delta-COP
Reference ARO-P11794
Note For research use only.
Molecular Constructor
Ser273–Leu511
Product name ARO-P11794-1MG
Uniprot ID P48444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Molecular weight 29.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser273-Leu511
Aliases /Synonyms Delta-coat protein, Coatomer subunit delta, COPD, ARCN1, Archain, Delta-COP
Reference ARO-P11794
Note For research use only.
Molecular Constructor
Ser273–Leu511
Product name ARO-P11794-50
Uniprot ID P48444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Molecular weight 29.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser273-Leu511
Aliases /Synonyms Delta-coat protein, Coatomer subunit delta, COPD, ARCN1, Archain, Delta-COP
Reference ARO-P11794
Note For research use only.
Molecular Constructor
Ser273–Leu511

Recombinant Human ARCN1 Protein: Structure, Activity and Application

Introduction

Recombinant Human ARCN1 Protein, also known as coatomer subunit delta, is a protein that plays a crucial role in the formation of COPI-coated vesicles in the early secretory pathway. It is a component of the coatomer complex, which is responsible for the retrograde transport of proteins from the Golgi apparatus to the endoplasmic reticulum. In this article, we will discuss the structure, activity, and application of this important protein.

Structure of Recombinant Human ARCN1 Protein

The Recombinant Human ARCN1 Protein is a 24 kDa protein that consists of 217 amino acids. It is composed of seven WD (tryptophan-aspartic acid) repeat domains, which are characteristic of proteins involved in protein-protein interactions. These domains are responsible for the binding of ARCN1 to other proteins in the coatomer complex. The crystal structure of the protein has been determined, revealing a compact, globular structure with a central pore that is thought to be the site of interaction with other coatomer subunits.

Activity of Recombinant Human ARCN1 Protein

The main activity of Recombinant Human ARCN1 Protein is its role in the formation of COPI-coated vesicles. These vesicles are essential for the retrograde transport of proteins from the Golgi apparatus to the endoplasmic reticulum, ensuring proper protein sorting and trafficking within the cell. ARCN1 interacts with other coatomer subunits to form the coatomer complex, which then binds to cargo molecules and initiates the formation of COPI-coated vesicles. It is also involved in maintaining the structural integrity of the Golgi apparatus and is essential for proper cell function.

Application of Recombinant Human ARCN1 Protein

Recombinant Human ARCN1 Protein has a wide range of applications in both research and medical fields. One of its main applications is in the study of the early secretory pathway and protein trafficking. By using recombinant ARCN1 protein, researchers can gain a better understanding of the mechanisms involved in COPI-coated vesicle formation and the role of coatomer subunits in this process.

In the medical field, Recombinant Human ARCN1 Protein has been used in the development of therapies for diseases related to protein trafficking defects. These include certain types of cancer, neurodegenerative disorders, and infectious diseases. By studying the structure and function of ARCN1, researchers can identify potential targets for drug development and design therapies to correct protein trafficking defects.

Conclusion

In summary, Recombinant Human ARCN1 Protein is an essential component of the coatomer complex and is involved in the formation of COPI-coated vesicles in the early secretory pathway. Its structure, activity, and application have been extensively studied, and it has shown great potential in both research and medical fields. With further research, this protein could potentially lead to the development of new therapies for diseases related to protein trafficking defects.

Recombinant Human ARCN1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARCN1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products