Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AP2B1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P63010
Molecular weight:
32.19 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Met1–Phe266
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AP2B1, N-His

Product name ARO-P12878-100
Uniprot ID P63010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKF
Molecular weight 32.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe266
Aliases /Synonyms Adaptor-related protein complex 2 subunit beta, ADTB2, CLAPB1, Beta-adaptin, AP105B, AP-2 complex subunit beta, Plasma membrane adaptor HA2/AP2 adaptin beta subunit, AP2B1, Adaptor protein complex AP-2 subunit beta, Clathrin assembly protein complex 2 beta large chain, Beta-2-adaptin
Reference ARO-P12878
Note For research use only.
Molecular Constructor
Met1–Phe266
Product name ARO-P12878-1MG
Uniprot ID P63010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKF
Molecular weight 32.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe266
Aliases /Synonyms Adaptor-related protein complex 2 subunit beta, ADTB2, CLAPB1, Beta-adaptin, AP105B, AP-2 complex subunit beta, Plasma membrane adaptor HA2/AP2 adaptin beta subunit, AP2B1, Adaptor protein complex AP-2 subunit beta, Clathrin assembly protein complex 2 beta large chain, Beta-2-adaptin
Reference ARO-P12878
Note For research use only.
Molecular Constructor
Met1–Phe266
Product name ARO-P12878-50
Uniprot ID P63010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKF
Molecular weight 32.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe266
Aliases /Synonyms Adaptor-related protein complex 2 subunit beta, ADTB2, CLAPB1, Beta-adaptin, AP105B, AP-2 complex subunit beta, Plasma membrane adaptor HA2/AP2 adaptin beta subunit, AP2B1, Adaptor protein complex AP-2 subunit beta, Clathrin assembly protein complex 2 beta large chain, Beta-2-adaptin
Reference ARO-P12878
Note For research use only.
Molecular Constructor
Met1–Phe266

Introduction to Recombinant Human AP2B1

Recombinant Human AP2B1, also known as Adaptor-Related Protein Complex 2 Subunit Beta 1, is a protein that plays a crucial role in the process of clathrin-mediated endocytosis. This protein is encoded by the AP2B1 gene and is a subunit of the Adaptor Protein 2 (AP-2) complex. The AP-2 complex is a heterotetrameric protein complex that is involved in the formation of clathrin-coated vesicles, which are essential for the internalization of extracellular molecules and membrane proteins. Recombinant Human AP2B1 is a highly conserved protein that is found in a variety of organisms, including humans.

Structure of Recombinant Human AP2B1

Recombinant Human AP2B1 is composed of 966 amino acids and has a molecular weight of approximately 108 kDa. It consists of four domains: the N-terminal domain, the hinge domain, the C-terminal domain, and the appendage domain. The N-terminal domain is responsible for binding to the plasma membrane, while the hinge domain connects the N-terminal and C-terminal domains. The C-terminal domain is involved in the interaction with clathrin and other proteins, and the appendage domain is responsible for binding to cargo molecules.

Activity of Recombinant Human AP2B1

Recombinant Human AP2B1 plays a crucial role in the process of clathrin-mediated endocytosis. This process involves the internalization of extracellular molecules and membrane proteins through the formation of clathrin-coated vesicles. The AP-2 complex, which includes Recombinant Human AP2B1, acts as an adaptor between the cargo molecules and the clathrin coat, facilitating their internalization into the cell. This process is essential for a wide range of cellular functions, including nutrient uptake, receptor signaling, and membrane protein turnover.

In addition to its role in clathrin-mediated endocytosis, Recombinant Human AP2B1 has also been shown to play a role in other cellular processes. It has been found to be involved in the regulation of cell migration and cell proliferation, and has been implicated in the development of various diseases, including cancer and neurodegenerative disorders.

Application of Recombinant Human AP2B1

Recombinant Human AP2B1 has a wide range of applications in both research and clinical settings. Due to its involvement in clathrin-mediated endocytosis, this protein is commonly used in studies related to cellular trafficking and membrane protein internalization. It is also a useful tool for studying the role of the AP-2 complex in various cellular processes.

In addition, Recombinant Human AP2B1 has potential clinical applications. As it has been linked to the development of various diseases, it is being investigated as a potential therapeutic target. Studies have shown that targeting Recombinant Human AP2B1 can inhibit cell proliferation and migration, making it a potential target for cancer treatment. It has also been suggested that modulating the activity of this protein could have beneficial effects in neurodegenerative disorders.

Conclusion

Recombinant Human AP2B1 is a highly conserved protein that plays a crucial role in clathrin-mediated endocytosis. Its structure and activity make it an essential component of the AP-2 complex, which is involved in the formation of clathrin-coated vesicles. This protein has a wide range of applications in research and has potential clinical implications. Further studies on Recombinant Human AP2B1 could lead to a better understanding of its role in various cellular processes and its potential as a therapeutic target.

Recombinant Human AP2B1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AP2B1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products