Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Placenta-specific protein 1(PLAC1) |
---|---|
Uniprot ID | Q9HBJ0 |
Uniprot link | https://www.uniprot.org/uniprot/Q9HBJ0 |
Expression system | Prokaryotic expression |
Sequence | MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGIEENLYFQGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSMHHHHHH |
Molecular weight | 48.75kDa |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5, 4M urea |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Gln23-Met212 |
Reference | PX-P4344 |
Note | For research use only |
Placenta-specific protein 1 is a small secreted cell surface protein (212 amino acids) encoded by the PLAC1 gene on the X chromosome. Since its discovery in 1999, PLAC1 has played a role in the development and maintenance of the placenta, including preeclampsia, fetal development, and many cancers.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.