Skip to main content
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

PAPD5 HUMAN Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product namePAPD5 HUMAN Protein
Uniprot IDQ8NDF8
Uniprot linkhttps://www.uniprot.org/uniprot/Q8NDF8
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMGSHHHHHHSGYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPAD SASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIES VIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVK VDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYG VLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVV LSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPK QLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSN NQYYHGKKRKHKRDAPLSDLCR
Molecular weight64.29kDa
Purity estimated85%
BufferTBS pH7.5 with urea 4M
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypeGly116-Gly433
Aliases /SynonymsTerminal nucleotidyltransferase 4B, TENT4B, Non-canonical poly(A) RNA polymerase PAPD5, PAP-associated domain-containing protein 5, Terminal guanylyltransferase, Terminaluridylyltransferase 3, TUTase 3, Topoisomerase-related function protein 4-2, TRF4-2
ReferencePX-P4250
NoteFor research use only

Description of PAPD5 HUMAN Protein

General information on PAPD5 Human Protein

PAPD5 protein is a member of non-canonical poly(a) polymerases also known as Cidl1-like proteins. Non-canonical poly(A) polymerases are very similar to canonical poly(a) polymerases but have different nucleotide-base recognition motif. The latter are responsible for the addition of a poly(A) tail to the 3’ end by poly(A) polymerases to mRNAs which leads to their degradation. Non canonical PAPs, such as PAPD5 protein, are responsible for the cytoplasmic polyadenylation of mRNAs and polyadenylation mediated degradation of RNAs. Other members of this family of proteins may also be involved in the addition of uridyl residues of RNAs.
Human PAPD5 protein is involved in the polyadenylation-mediated degradation of aberrant pre-rRNAs. This protein has also been reported to be involved in the degradation of replication-dependent histone mRNAs. These mRNAs do not have a poly(A) tail but end in a stem-loop structure. In this case, the degradation pathway starts with PAPD5 protein adding a poly(U) tail which is recognized by the Lsm1-7 complex. This recognition leads to decapping and degradation of the mRNAs. Other functions of PAPD5 protein include DNA binding, DNA-directed DNA polymerase activity, guanylyltransferase activity, metal ion binding, polynucleotide adenylyltransferase activity, RNA binding, telomerase RNA binding. PAPD5 protein is involved in cell division, cell cycle carbohydrate homeostasis and other biological processes.
PAPD5 protein is believed to act as a kind of scavenger enzyme for aberrant RNAs which, due to misfolding and misprocessing, cannot form the correct interactions. This function is similar to the role of TRAMP4 complex in yeast. Like the latter, PAPD5 protein can be found in nucleus which suggests that the protein may be part of a nuclear surveillance machinery. The downregulation of PAPD5 may not lead to a significant change in RNA level. This seems to suggest that the RNA surveillance system is most likely reductant, making sure that deleterious aberrant RNAs are degraded with high efficiency.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “PAPD5 HUMAN Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products