Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Mycoplasma LppA Recombinant Protein |
---|---|
Uniprot ID | P55801 |
Uniprot link | http://www.uniprot.org/uniprot/P55801 |
Origin species | Mycoplasma |
Expression system | Prokaryotic expression |
Sequence | MGSSHHHHHHSSGLVPRGSHMISNSCSTRNSNAKQPDKKPEKPNENTPKTPSKPDESKQPDNNNTNPGDSNNGSNNPEIK PDPSENPQSDQPMDKPDEKIDKPSHSDKPQADDSNNNRDIFSDLDKISKEISFETFSFYTQRDAVTALVDLQKDPSTIYT IFSKDYKTIFDKYHIQFLANNEESANNEKGLIEKVKLKFTHKKFDQSKILDFIFTGFKKNEYTSITNNKEKYITKREKVE KITDLFPSLIGYVLLYSQDHNQYKNLMEAKNVINFEDLENGNSSLFIDKAPLLNVATIKDYLFEFNPELGKLYKEKITAV KYDDYNGILGVKLEIENRDFDPKTTKEPIIEKEFVFDNFRKVNIKDNEKNPLSLFLTQDKFKEMTKSGLLKTKIQELRSS NKLEKKELLQDKKIDFLKQQIFKNLLVDINDNSHNIYRSQSTLSLGSNKTYKSILGLAGGFSIYPFHTSINKDSIKNIYL SINKDEENVHKAIIEFEVYIPVFSTGFSDLKSYATSGDEKYLVLKIVQTTSIQCGRGSHHHHHHHHHH |
Molecular weight | 62,97 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 85% |
Buffer | PBS, imidazole 250mM |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Protein Accession | NP_975025.1 |
Spec:Entrez GeneID | 2744850 |
Spec:SwissProtID | P55801 |
NCBI Reference | NP_975025.1 |
Aliases /Synonyms | LppA, immunodominant protein P72, MSC_0014, P72 |
Reference | PX-P1122 |
Note | For research use only |
Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.