Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Mycoplasma LppA Recombinant Protein |
|---|---|
| Uniprot ID | P55801 |
| Uniprot link | http://www.uniprot.org/uniprot/P55801 |
| Origin species | Mycoplasma |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMISNSCSTRNSNAKQPDKKPEKPNENTPKTPSKPDESKQPDNNNTNPGDSNNGSNNPEIK PDPSENPQSDQPMDKPDEKIDKPSHSDKPQADDSNNNRDIFSDLDKISKEISFETFSFYTQRDAVTALVDLQKDPSTIYT IFSKDYKTIFDKYHIQFLANNEESANNEKGLIEKVKLKFTHKKFDQSKILDFIFTGFKKNEYTSITNNKEKYITKREKVE KITDLFPSLIGYVLLYSQDHNQYKNLMEAKNVINFEDLENGNSSLFIDKAPLLNVATIKDYLFEFNPELGKLYKEKITAV KYDDYNGILGVKLEIENRDFDPKTTKEPIIEKEFVFDNFRKVNIKDNEKNPLSLFLTQDKFKEMTKSGLLKTKIQELRSS NKLEKKELLQDKKIDFLKQQIFKNLLVDINDNSHNIYRSQSTLSLGSNKTYKSILGLAGGFSIYPFHTSINKDSIKNIYL SINKDEENVHKAIIEFEVYIPVFSTGFSDLKSYATSGDEKYLVLKIVQTTSIQCGRGSHHHHHHHHHH |
| Molecular weight | 62,97 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | PBS, imidazole 250mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | NP_975025.1 |
| Spec:Entrez GeneID | 2744850 |
| Spec:SwissProtID | P55801 |
| NCBI Reference | NP_975025.1 |
| Aliases /Synonyms | LppA, immunodominant protein P72, MSC_0014, P72 |
| Reference | PX-P1122 |
| Note | For research use only |
Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.