Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Mycoplasma LppA Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameMycoplasma LppA Recombinant Protein
Uniprot IDP55801
Uniprot linkhttp://www.uniprot.org/uniprot/P55801
Origin speciesMycoplasma
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMISNSCSTRNSNAKQPDKKPEKPNENTPKTPSKPDESKQPDNNNTNPGDSNNGSNNPEIK PDPSENPQSDQPMDKPDEKIDKPSHSDKPQADDSNNNRDIFSDLDKISKEISFETFSFYTQRDAVTALVDLQKDPSTIYT IFSKDYKTIFDKYHIQFLANNEESANNEKGLIEKVKLKFTHKKFDQSKILDFIFTGFKKNEYTSITNNKEKYITKREKVE KITDLFPSLIGYVLLYSQDHNQYKNLMEAKNVINFEDLENGNSSLFIDKAPLLNVATIKDYLFEFNPELGKLYKEKITAV KYDDYNGILGVKLEIENRDFDPKTTKEPIIEKEFVFDNFRKVNIKDNEKNPLSLFLTQDKFKEMTKSGLLKTKIQELRSS NKLEKKELLQDKKIDFLKQQIFKNLLVDINDNSHNIYRSQSTLSLGSNKTYKSILGLAGGFSIYPFHTSINKDSIKNIYL SINKDEENVHKAIIEFEVYIPVFSTGFSDLKSYATSGDEKYLVLKIVQTTSIQCGRGSHHHHHHHHHH
Molecular weight62,97 kDa
Protein delivered with Tag?Yes
Purity estimated85%
BufferPBS, imidazole 250mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_975025.1
Spec:Entrez GeneID2744850
Spec:SwissProtIDP55801
NCBI ReferenceNP_975025.1
Aliases /SynonymsLppA, immunodominant protein P72, MSC_0014, P72
ReferencePX-P1122
NoteFor research use only

Description of Mycoplasma LppA Recombinant Protein

General information on Mycoplasma LppA Recombinant Protein:

Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.

Publication

  • 1: Frey J, Cheng X, Monnerat MP, Abdo EM, Krawinkler M, Bölske G, Nicolet J._x000D_ Genetic and serological analysis of the immunogenic 67-kDa lipoprotein of_x000D_ Mycoplasma sp. bovine group 7. Res Microbiol. 1998 Jan;149(1):55-64. PubMed PMID:_x000D_ 9766210.
  • _x000D_ _x000D_ _x000D_
  • 2: Cheng X, Nicolet J, Miserez R, Kuhnert P, Krampe M, Pilloud T, Abdo EM, Griot _x000D_ C, Frey J. Characterization of the gene for an immunodominant 72 kDa lipoprotein _x000D_ of Mycoplasma mycoides subsp. mycoides small colony type. Microbiology. 1996_x000D_ Dec;142 ( Pt 12):3515-24. PubMed PMID: 9004514.
  • _x000D_ _x000D_ _x000D_
  • 3: Westberg J, Persson A, Holmberg A, Goesmann A, Lundeberg J, Johansson KE,_x000D_ Pettersson B, Uhlén M. The genome sequence of Mycoplasma mycoides subsp. mycoides_x000D_ SC type strain PG1T, the causative agent of contagious bovine pleuropneumonia_x000D_ (CBPP). Genome Res. 2004 Feb;14(2):221-7. PubMed PMID: 14762060; PubMed Central_x000D_ PMCID: PMC327097.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mycoplasma LppA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products