Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Insect |
Applications | Elisa, WB |
Product name | Mucin-4(MUC4)(1869-1925) |
---|---|
Uniprot ID | Q99102 |
Uniprot link | https://www.uniprot.org/uniprot/Q99102 |
Origin species | Human |
Expression system | Eukaryotic expression |
Sequence | MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH* |
Molecular weight | 9.55kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | / |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Insect |
Fragment Type | Gly1869-Asn1925 |
Aliases /Synonyms | Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin |
Reference | PX-P4275 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.