Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Mucin-1(Ser24-Pro146)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Mucin-1(Ser24-Pro146) |
|---|---|
| Uniprot ID | P15941 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRP |
| Molecular weight | 14.25 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser24-Pro146 |
| Aliases /Synonyms | MUC-1,Breast carcinoma-associated antigen DF3,Cancer antigen 15-3,CA 15-3,Carcinoma-associated mucin,Episialin,H23AG,Krebs von den Lungen-6,KL-6 ,PEMT,Peanut-reactive urinary mucin,PUM,Polymorphic epithelial mucin,PEM,Tumor-associated epithelial membrane antigen,EMA,Tumor-associated mucin ,CD_antigen: CD227 |
| Reference | PX-P4730 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.