Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | Mouse Arginine deiminase type-4 Recombinant Protein |
|---|---|
| Uniprot ID | Q9Z183 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9Z183 |
| Origin species | House Mouse |
| Expression system | Eukaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMAQGAVIHVAPEQPTHAVCVVGTATPLDVRGSA |
| Molecular weight | 100.24 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 20% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Fragment Type | Full-length |
| Protein Accession | NP_035191.2 |
| Spec:Entrez GeneID | 18602 |
| Spec:NCBI Gene Aliases | Pad4, Pdi4 |
| Spec:SwissProtID | Q9Z183 |
| NCBI Reference | NP_035191.2 |
| Aliases /Synonyms | Protein-arginine deiminase type-4 Mouse, peptidyl arginine deiminase, type IV, Protein-arginine deiminase type-4, Peptidylarginine deiminase IV, Protein-arginine deiminase type IV |
| Reference | PX-P2085 |
| Note | For research use only |
PADI4 is located in the cytoplasm, nucleus and in cytoplasmic granules of eosinophils and neutrophils. It is not expressed in peripheral monocytes or lymphocytes. It is also expressed in rheumatoid arthritis synovial tissues. It may play a role in in granulocyte and macrophage development leading to inflammation and immune response. PADI4 plays a role in the epigenetics, the deimination of arginines on histones 3 and 4 can act antagonistically to arginine methylation.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.