Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Microtubule-associated protein tau(MAPT)(1-441) |
|---|---|
| Uniprot ID | P10636-8 |
| Uniprot link | http://www.uniprot.org/uniprot/P10636-8 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKST PTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVV RTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIV YKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG AEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL |
| Purity estimated | >80% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Leu441 |
| Aliases /Synonyms | Neurofibrillary tangle protein,Paired helical filament-tau,MAPTL, MTBT1, TAU |
| Reference | PX-P4601 |
| Note | For research use only |
Microtubule-associated protein tau (MAPT) promotes microtubule assembly and stability, and may participate in the establishment and maintenance of neuronal polarity. The C-terminus binds to axon microtubules, while the N-terminus binds to the plasma membrane components, indicating that tau acts as a linker between the two. Axon polarity is predetermined by the TAU/MAPT positioning (in neuronal cells) in the cell body domain defined by the centrosome. The short isoform can make the cytoskeleton plastic, while the longer isoform can give priority to its stabilizing effect.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.