Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Marinobacter MARHY0478 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Marinobacter MARHY0478 Recombinant Protein |
|---|---|
| Uniprot ID | H8WEC1 |
| Uniprot link | http://www.uniprot.org/uniprot/H8WEC1 |
| Origin species | Marinobacter |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLMGNLGTSYGVMPVDVATAQSLSMFNEQVSATYYNPAALTKDPRGELTAGILHSEQELRSDNPNASGDIV SDSPSQHVLIGMKTNLGSLTRFGHPIYLGFIAGVEKYGKEMLAFSSETSESGQFLQYGKEPLFLNIGGATPIWRGISAGA SVRVTLEATANLDAVSTLGGETSRERLAVNAEPSLKTILGTNIDLGSTFCPESDCFLNGWETALTYRTKSSASTTVDSNI IVTQTIPDPGLSLAVTTIDSFQPETIAIGTQYSGDGWRIGGSIEQQNWSELEDEFSGDSIKDQGSVASGNRIGFDDILIP RLGAEYQLNKNFAVRGGVAYEESPLKTTRNPELNYLDTDKLVVGLGISATYDRTRLLAYPVRLDLGYQYQQLQERDFTVV DYDGDETSVTADGDIHVFSGSITLKF |
| Molecular weight | 46,10 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS pH 7.4 with imidazole 250mM and Urea 4M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | H8WEC1 |
| Spec:Entrez GeneID | 12921111 |
| Spec:SwissProtID | H8WEC1 |
| NCBI Reference | H8WEC1 |
| Aliases /Synonyms | MARHY0478, long-chain fatty acid transporter, Putative hydrophobic compounds transporter |
| Reference | PX-P1123 |
| Note | For research use only |
Description of Marinobacter MARHY0478 Recombinant Protein
General information on Marinobacter MARHY0478 Recombinant Protein:
Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.