Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenercept Biosimilar – Anti-TNF fusion protein – Research Grade

  • PX-TA2017-50
  • Validated ELISA
Uniprot ID:
P01375

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade

Product name Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2017
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1A (tumor necrosis factor receptor (TNFR) superfamilly member 1A, TNFAR, TNF-RI, TNF-R-I, p55, CD120a)]2 - IGHG1 Fc (Fragment constant)
Product name Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2017
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1A (tumor necrosis factor receptor (TNFR) superfamilly member 1A, TNFAR, TNF-RI, TNF-R-I, p55, CD120a)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2017-50
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2017
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1A (tumor necrosis factor receptor (TNFR) superfamilly member 1A, TNFAR, TNF-RI, TNF-R-I, p55, CD120a)]2 - IGHG1 Fc (Fragment constant)

Introduction to Lenercept Biosimilar

Lenercept Biosimilar is a research grade anti-TNF fusion protein that has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases. It is a biosimilar of etanercept, a widely used anti-TNF drug, and is designed to have similar structure and activity.

Structure of Lenercept Biosimilar

Lenercept Biosimilar is a recombinant fusion protein consisting of two components – a soluble TNF receptor and the Fc region of human immunoglobulin G1 (IgG1). The TNF receptor component is composed of the extracellular domain of the human TNF receptor 2 (TNFR2) and the transmembrane and cytoplasmic domains of the human TNF receptor 1 (TNFR1). The Fc region, on the other hand, is responsible for extending the half-life of the protein in the body by binding to the neonatal Fc receptor (FcRn).

The structure of Lenercept Biosimilar is similar to that of etanercept, with the only difference being the source of the TNF receptor component. While etanercept is derived from the extracellular domain of the human TNF receptor 2, Lenercept Biosimilar uses the extracellular domain of the human TNF receptor 2. This difference in the source of the TNF receptor component does not affect the overall structure and function of Lenercept Biosimilar.

Mechanism of Action

Lenercept Biosimilar acts as a competitive inhibitor of TNF, a pro-inflammatory cytokine that plays a crucial role in various inflammatory and autoimmune diseases. The TNF receptor component of Lenercept Biosimilar binds to TNF with high affinity, preventing it from binding to its natural receptors on the cell surface. This blocks the downstream signaling pathways activated by TNF, thereby reducing inflammation and tissue damage.

The Fc region of Lenercept Biosimilar also plays a role in its mechanism of action. It extends the half-life of the protein in the body, allowing for prolonged inhibition of TNF and providing sustained therapeutic effects.

Therapeutic Applications

Lenercept Biosimilar has shown promising results in preclinical studies and is currently being evaluated for its therapeutic potential in various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, Crohn’s disease, and psoriatic arthritis.

In a phase I clinical trial, Lenercept Biosimilar was found to be safe and well-tolerated in healthy volunteers. It also showed comparable pharmacokinetic and pharmacodynamic profiles to etanercept, further supporting its potential as a biosimilar of the widely used anti-TNF drug.

Further clinical trials are needed to establish the efficacy and safety of Lenercept Biosimilar in treating specific diseases. If successful, it has the potential to provide a more affordable treatment option for patients, as biosimilars are typically priced lower than their reference biologics.

Conclusion

Lenercept Biosimilar is a promising anti-TNF fusion protein that has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases. Its structure and mechanism of action are similar to that of etanercept, but with a different source of the TNF receptor component. Further clinical studies will determine its efficacy and safety in treating specific diseases, and if successful, it has the potential to provide a more affordable treatment option for patients.

SDS-PAGE for Research Grade Lenercept

SDS-PAGE for Research Grade Lenercept

Research Grade Lenercept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Lenercept in ELISA Assay

Research Grade Lenercept in ELISA Assay

Research Grade Lenercept can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Lenercept Biosimilar – Anti-TNF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products