Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

JAK2 protein – Tyrosine-protein kinase JAK2(JAK2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O60674
Molecular weight:
35kDa and 30kDa(35.93kDa)

Original price was: €269.00.Current price is: €210.00.

50ug 22% OFF + 210 loyalty points
Asn508~Ala800
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

JAK2 protein - Tyrosine-protein kinase JAK2(JAK2)

Product name JAK2 protein - Tyrosine-protein kinase JAK2(JAK2)
Uniprot ID O60674
Uniprot link https://www.uniprot.org/uniprot/O60674
Expression system Prokaryotic expression
Raw Antigen Sequence NLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRA
Molecular weight 35kDa and 30kDa(35.93kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn508~Ala800
Aliases /Synonyms Janus kinase 2 , JAK-2
Reference PX-P4590
Note For research use only
Molecular Constructor
Asn508~Ala800
Product name JAK2 protein - Tyrosine-protein kinase JAK2(JAK2)
Uniprot ID O60674
Uniprot link https://www.uniprot.org/uniprot/O60674
Expression system Prokaryotic expression
Raw Antigen Sequence NLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRA
Molecular weight 35kDa and 30kDa(35.93kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn508~Ala800
Aliases /Synonyms Janus kinase 2 , JAK-2
Reference PX-P4590
Note For research use only
Molecular Constructor
Asn508~Ala800
Product name PX-P4590-1MG
Uniprot ID O60674
Uniprot link https://www.uniprot.org/uniprot/O60674
Expression system Prokaryotic expression
Raw Antigen Sequence NLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRA
Molecular weight 35kDa and 30kDa(35.93kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn508~Ala800
Aliases /Synonyms Janus kinase 2 , JAK-2
Reference PX-P4590
Note For research use only
Molecular Constructor
Asn508~Ala800

General information on JAK2 protein



JAK2 Protein stands for Janus Kinase Protein which is a non-receptor tyrosine kinase. This protein is member of the Janus kinase family and has been implicated in signaling by members of the type II cytokine receptor family, the GM-CSF receptor family and the gp130 receptor family and the single chain receptors. JAK2 protein is different from other JAK kinases because it lacks Src homology binding domains (SH2/SH3) and contains up to seven JAK homology domains.

This protein is involved in several cellular activities such as cell growth, cell development, cell differentiation and histone modifications. Jak2 protein is also involved in innate and adaptative immunity response. In the cytoplasm, JAK2 protein, plays a pivotal role in signal transduction via its association with either type I receptors such as prolactin, leptin, erythropoietin and even growth hormone (GHR) or type II receptors including INF-alpha, IFN-beta and INF-gamma. JAK2 protein is also associated with different interleukins which is also linked to signal transduction.

Following the ligand-binding, JAK2 protein gets activated via transphosphorylation of receptor JAK membrane molecules. Once activated, these proteins phosphorylate substrates on tyrosine which provides docking sites to recruit downstream signaling proteins such as STAT family of proteins. The latter are phosphorylated and form a homodimer or a heterodimer and translocate to the nucleus where they activate gene transcription. In addition, JAK2 protein also mediates angiotensin-2-induced ARHGEF1 phosphorylation. JAK2 kinase lays is involved in cell cycle by phosphorylating CDKN1B protein. Other interactions involve its cooperation with TEC vis reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, JAK2 protein is essential for the phosphorylation of ‘Tyr-41’ of histone H3 (H3Y41ph) which promotes exclusion of CBX5 (HP1 alpha) from chromatin. Hence JAk2 protein has been linked to certain malignancies. It has been shown that the absence of JAK2 kinase is lethal in embryonic mice.

JAK2 protein - Tyrosine-protein kinase JAK2(JAK2)

There are no reviews yet.

Be the first to review “JAK2 protein – Tyrosine-protein kinase JAK2(JAK2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products