Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200)

  • ARO-A13089-100
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €443.00.Current price is: €366.00.

100ug 17% OFF + 366 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200) in ELISA Assay
SDS-PAGE for InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200)

InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200)

Product name ARO-A13089-100
Uniprot ID Q2VE61
Raw Antigen Sequence SQFYSVDLHDEIEQIGSEKTQNVTVNPGPFAQTRYAPVNWGHGEINDSTTVEPILDGPYQPTTFKPPNDYWLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSQTNRQYVLFGENKQFNVENSSDKWKFFEMFKGSSQSDFSNRRTLTSNNRLVGMLKYGGRVWTFHGETPRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNTRNVVPLSLSSRSIQYRRAQVNEDITISKTSLWKEMQYNRDIIIRFKFGNSVINRE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Outer capsid protein VP4, VP4, Rotavirus A
Reference ARO-A13089
Clonality Monoclonal Antibody
Protein Name Outer capsid protein VP4
Product name ARO-A13089-1MG
Uniprot ID Q2VE61
Raw Antigen Sequence SQFYSVDLHDEIEQIGSEKTQNVTVNPGPFAQTRYAPVNWGHGEINDSTTVEPILDGPYQPTTFKPPNDYWLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSQTNRQYVLFGENKQFNVENSSDKWKFFEMFKGSSQSDFSNRRTLTSNNRLVGMLKYGGRVWTFHGETPRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNTRNVVPLSLSSRSIQYRRAQVNEDITISKTSLWKEMQYNRDIIIRFKFGNSVINRE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Outer capsid protein VP4, VP4, Rotavirus A
Reference ARO-A13089
Clonality Monoclonal Antibody
Protein Name Outer capsid protein VP4
Product name ARO-A13089-50
Uniprot ID Q2VE61
Raw Antigen Sequence SQFYSVDLHDEIEQIGSEKTQNVTVNPGPFAQTRYAPVNWGHGEINDSTTVEPILDGPYQPTTFKPPNDYWLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSQTNRQYVLFGENKQFNVENSSDKWKFFEMFKGSSQSDFSNRRTLTSNNRLVGMLKYGGRVWTFHGETPRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNTRNVVPLSLSSRSIQYRRAQVNEDITISKTSLWKEMQYNRDIIIRFKFGNSVINRE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Outer capsid protein VP4, VP4, Rotavirus A
Reference ARO-A13089
Clonality Monoclonal Antibody
Protein Name Outer capsid protein VP4

InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200) in ELISA Assay

InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200) in ELISA Assay

InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200)

SDS-PAGE for InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200)

InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Rotavirus A VP4/Outer capsid protein VP4 Antibody (Iv0200)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products