Brand: ProteoGenix

InVivoMAb Anti-Mouse CD8a/Lyt2 Antibody (Iv0165)

ARO-A13192-50
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Rat

Original price was: €325.00.Current price is: €256.00.

50ug 21% OFF + 256 loyalty points

Size Size

50ug Original price was: €325.00.Current price is: €256.00.
100ug Original price was: €465.00.Current price is: €366.00.
1MG Original price was: €1,294.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

InVivoMAb Anti-Mouse CD8a/Lyt2 Antibody (Iv0165)

Product name	ARO-A13192-100
Uniprot ID	P01731
Raw Antigen Sequence	MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rat
Aliases /Synonyms	Anti-T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2
Reference	ARO-A13192
Clonality	Monoclonal Antibody
Protein Name	T-cell surface glycoprotein CD8 alpha chain

Product name	ARO-A13192-1MG
Uniprot ID	P01731
Raw Antigen Sequence	MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rat
Aliases /Synonyms	Anti-T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2
Reference	ARO-A13192
Clonality	Monoclonal Antibody
Protein Name	T-cell surface glycoprotein CD8 alpha chain

Product name	ARO-A13192-50
Uniprot ID	P01731
Raw Antigen Sequence	MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rat
Aliases /Synonyms	Anti-T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, CD8a, Cd8a, Lyt-2, Lyt2
Reference	ARO-A13192
Clonality	Monoclonal Antibody
Protein Name	T-cell surface glycoprotein CD8 alpha chain

Datasheet

SDS-PAGE for InVivoMAb Anti-Mouse CD8a/Lyt2 Antibody (Iv0165)

InVivoMAb Anti-Mouse CD8a/Lyt2 Antibody (Iv0165), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Mouse CD8a/Lyt2 Antibody (Iv0165)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *