Brand: ProteoGenix

InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody (Iv0225)

ARO-A12992-100
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Mouse

Original price was: €589.00.Current price is: €475.00.

100ug 19% OFF + 475 loyalty points

Size Size

50ug Original price was: €403.00.Current price is: €333.00.
100ug Original price was: €589.00.Current price is: €475.00.
1MG Original price was: €1,778.00.Current price is: €1,378.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody (Iv0225)

Product name	ARO-A12992-100
Uniprot ID	P19437 & P22646
Raw Antigen Sequence	MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-CD20, Bispecific, B-lymphocyte antigen CD20, B-cell differentiation antigen Ly-44, Lymphocyte antigen 44, Membrane-spanning 4-domains subfamily A member 1, Ms4a1, Cd20, Ly-44, Ms4a2, T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, Cd3e
Reference	ARO-A12992
Clonality	Monoclonal Antibody
Protein Name	CD20

Product name	ARO-A12992-1MG
Uniprot ID	P19437 & P22646
Raw Antigen Sequence	MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-CD20, Bispecific, B-lymphocyte antigen CD20, B-cell differentiation antigen Ly-44, Lymphocyte antigen 44, Membrane-spanning 4-domains subfamily A member 1, Ms4a1, Cd20, Ly-44, Ms4a2, T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, Cd3e
Reference	ARO-A12992
Clonality	Monoclonal Antibody
Protein Name	CD20

Product name	ARO-A12992-50
Uniprot ID	P19437 & P22646
Raw Antigen Sequence	MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-CD20, Bispecific, B-lymphocyte antigen CD20, B-cell differentiation antigen Ly-44, Lymphocyte antigen 44, Membrane-spanning 4-domains subfamily A member 1, Ms4a1, Cd20, Ly-44, Ms4a2, T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, Cd3e
Reference	ARO-A12992
Clonality	Monoclonal Antibody
Protein Name	CD20

Datasheet

SDS-PAGE for InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody (Iv0225)

InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody (Iv0225), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody (Iv0225)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *