Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human IGF1 (Iv0063)

  • ARO-A13311-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €351.00.Current price is: €256.00.

50ug 27% OFF + 256 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)
SDS-PAGE for InVivoMAb Anti-Human IGF1 (Iv0063)
Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)
SEC-HPLC of InVivoMAb Anti-Human IGF1 (Iv0063)
Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)
Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

InVivoMAb Anti-Human IGF1 (Iv0063)

Product name ARO-A13311-100
Uniprot ID P05019
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IGF-I, IGF1, Mechano growth factor, MGF, Insulin-like growth factor I, IBP1, Somatomedin-C
Reference ARO-A13311
Clonality Monoclonal Antibody
Protein Name IGF-I
Product name ARO-A13311-1MG
Uniprot ID P05019
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IGF-I, IGF1, Mechano growth factor, MGF, Insulin-like growth factor I, IBP1, Somatomedin-C
Reference ARO-A13311
Clonality Monoclonal Antibody
Protein Name IGF-I
Product name ARO-A13311-50
Uniprot ID P05019
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IGF-I, IGF1, Mechano growth factor, MGF, Insulin-like growth factor I, IBP1, Somatomedin-C
Reference ARO-A13311
Clonality Monoclonal Antibody
Protein Name IGF-I

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow-cytometry using anti-human IGF2 antibody.HepG2 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IGF2 antibody monoclonal antibody (Catalog # ARO-A13311 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human IGF1 (Iv0063)

SDS-PAGE for InVivoMAb Anti-Human IGF1 (Iv0063)

InVivoMAb Anti-Human IGF1 (Iv0063), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow-cytometry using anti-human IGF1 antibody.Human Jurkat cell line were stained with an irrelevant antibody (Blue Histogram) or an anti-human IGF1 antibody monoclonal antibody (Catalog # ARO-A13311 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SEC-HPLC of InVivoMAb Anti-Human IGF1 (Iv0063)

SEC-HPLC of InVivoMAb Anti-Human IGF1 (Iv0063)

InVivoMAb Anti-Human IGF1 (Iv0063) was analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow-cytometry using anti-human IGF2 antibody.A549 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IGF2 antibody monoclonal antibody (Catalog # ARO-A13311 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow Cytometry results for InVivoMAb Anti-Human IGF1 (Iv0063)

Flow-cytometry using anti-human IGF1 antibody.HeLa cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IGF1 antibody monoclonal antibody (Catalog # ARO-A13311 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IGF1 (Iv0063)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products