Brand: ProteoGenix

InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057)

ARO-A13317-50
Validated ELISA

Clonality:: Monoclonal Antibody
Host species:: Human

Original price was: €353.00.Current price is: €256.00.

50ug 27% OFF + 256 loyalty points

Size Size

50ug Original price was: €353.00.Current price is: €256.00.
100ug Original price was: €439.00.Current price is: €366.00.
1MG Original price was: €1,369.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057)

Datasheet

InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057)

Product name	ARO-A13317-100
Uniprot ID	P49771
Raw Antigen Sequence	MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-SL cytokine, FLT3LG, Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L
Reference	ARO-A13317
Clonality	Monoclonal Antibody
Protein Name	SL cytokine

Product name	ARO-A13317-1MG
Uniprot ID	P49771
Raw Antigen Sequence	MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-SL cytokine, FLT3LG, Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L
Reference	ARO-A13317
Clonality	Monoclonal Antibody
Protein Name	SL cytokine

Product name	ARO-A13317-50
Uniprot ID	P49771
Raw Antigen Sequence	MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-SL cytokine, FLT3LG, Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L
Reference	ARO-A13317
Clonality	Monoclonal Antibody
Protein Name	SL cytokine

Datasheet

SDS-PAGE for InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057)

InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057) binds to Recombinant Human Flt3 ligand/FLT3LG Protein, N-His in ELISA Assay

Recombinant Human Flt3 ligand/FLT3LG Protein, N-His(cat. No.ARO-P11333) at 0.5Âµg/mL (100ÂµL/well) can bind InVivoMAb Anti-Human Flt3 ligand/FLT3LG (Iv0057) in indirect ELISA with Goat secondary antibody measured by OD450.