Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Invasin |
---|---|
Uniprot ID | P19196 |
Uniprot link | https://www.uniprot.org/uniprot/P19196 |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG IRIQADQTPEDLDMEDNDIIEAHREQIGGVNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQ GKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTL WGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ |
Molecular weight | 32.69kDa |
Purity estimated | >50% by SDS-PAGE |
Buffer | 20 mM Tris-HCl pH8.0, 100 mM NaCl,1 mM DTT,0,1% sodium azide,0.1mM EDTA, 10% glycerol |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Val652-Gln836 |
Aliases /Synonyms | Invasin |
Reference | PX-P4377 |
Note | For research use only |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.