Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Interleukin-31 receptor subunit alpha(IL31RA) |
|---|---|
| Uniprot ID | Q8NI17 |
| Uniprot link | https://www.uniprot.org/uniprot/Q8NI17 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD |
| Molecular weight | 55.75 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val130-Asp622 |
| Protein Accession | Q8NI17 |
| Spec:Entrez GeneID | 133396 |
| Spec:NCBI Gene Aliases | CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17 |
| Spec:SwissProtID | Q8WYJ0 |
| NCBI Reference | Q8NI17 |
| Aliases /Synonyms | IL-31 receptor subunit alpha,IL-31R subunit alpha,IL-31R-alpha,IL-31RA,Cytokine receptor-like 3,GLM-R,hGLM-R,Gp130-like monocyte receptor,Gp130-like receptor,ZcytoR17,CRL3, GPL |
| Reference | PX-P4802 |
| Note | For research use only |
Immobilized Interleukin-2 receptor subunit alpha(IL2RA) (cat. No.PX-P4704) at 0.5µg/mL (100µL/well) can bind Daclizumab Biosimilar - Anti-IL2RA mAb (cat. No.PX-TA1038) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 175.8M.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.