Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-1 alpha(IL1A)His Tag

Host species:
Mammalian cells
Uniprot ID:
P01583
Molecular weight:
21.3kDa

Original price was: €298.00.Current price is: €259.00.

50ug 13% OFF + 259 loyalty points
Ser113–Ala271 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-1 alpha(IL1A)His Tag

Product name Interleukin-1 alpha(IL1A)His Tag
Uniprot ID P01583
Uniprot link https://www.uniprot.org/uniprot/P01583
Expression system Eukaryotic expression
Raw Antigen Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Molecular weight 21.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser113-Ala271
Protein Accession P01583
Spec:Entrez GeneID 3552
Spec:NCBI Gene Aliases IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Spec:SwissProtID Q53QF9
NCBI Reference P01583
Aliases /Synonyms IL-1 alpha,Hematopoietin-1,IL1F1
Reference PX-P4854
Note For research use only
Molecular Constructor
Ser113–Ala271 His
Product name Interleukin-1 alpha(IL1A)His Tag
Uniprot ID P01583
Uniprot link https://www.uniprot.org/uniprot/P01583
Expression system Eukaryotic expression
Raw Antigen Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Molecular weight 21.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser113-Ala271
Protein Accession P01583
Spec:Entrez GeneID 3552
Spec:NCBI Gene Aliases IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Spec:SwissProtID Q53QF9
NCBI Reference P01583
Aliases /Synonyms IL-1 alpha,Hematopoietin-1,IL1F1
Reference PX-P4854
Note For research use only
Molecular Constructor
Ser113–Ala271 His
Product name PX-P4854-1MG
Uniprot ID P01583
Uniprot link https://www.uniprot.org/uniprot/P01583
Expression system Eukaryotic expression
Raw Antigen Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Molecular weight 21.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser113-Ala271
Protein Accession P01583
Spec:Entrez GeneID 3552
Spec:NCBI Gene Aliases IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Spec:SwissProtID Q53QF9
NCBI Reference P01583
Aliases /Synonyms IL-1 alpha,Hematopoietin-1,IL1F1
Reference PX-P4854
Note For research use only
Molecular Constructor
Ser113–Ala271 His

Interleukin-1 alpha(IL1A)His Tag

There are no reviews yet.

Be the first to review “Interleukin-1 alpha(IL1A)His Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products